KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_000180Help
Entry
PCC21_000180      CDS       T02320                                 

Definition
(GenBank) phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00010  Glycolysis / Gluconeogenesis
pcc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_000180
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     PCC21_000180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase SHOCT Acid_PPase Hydrolase_like HAD Hydrolase_6 Phage_GPD PNK3P
Motif
Other DBs
NCBI-ProteinID: AFR01421
Position
17512..18123
Genome map
AA seq 203 aa AA seqDB search
MLYIFDLGNVVIDIDFNRVLGVWSNLSSAPLATLQERFVMGDAFEQHERGEISDEEFATR
LCQEMGIALSFEQFTAGWQAIFVALRPEVIDIMQRLRQEGHRVVILSNTNRLHCSHWPAL
FPEVATAADRLYLSQEIGLRKPELAIYQYVLTEEGVSPAQAVFFDDNAANVDAAQSLGIH
SILVTDRQVVPDFFAMQATTAKA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggcaatgtcgtcatagatattgatttcaatagagtattg
ggtgtctggagtaatctgagcagcgcgccgctcgcgacgttgcaagagcgttttgtcatg
ggcgacgcgtttgaacagcatgagcggggtgagatcagcgacgaggaatttgccaccaga
ctgtgtcaggaaatgggtatcgccctgagcttcgaacaattcaccgctggctggcaggct
atttttgtcgcgttgcgtcctgaggttatcgacatcatgcagcgcctgcgtcaggaaggg
caccgcgtggtgattctgtcgaacaccaatcgcctccactgttcacactggcctgcgcta
ttcccagaagtggcgacggcggctgacagactctacctgtcgcaagagattggattacgt
aagccggagctggcgatttaccaatatgtcctgacagaggaaggcgtttcgcctgcgcaa
gccgtcttttttgacgataatgctgcgaacgtcgatgcagcacaaagtctgggcattcac
agcattctggtgaccgatcgtcaggtggtgccggattttttcgccatgcaggcgacgacg
gctaaagcataa

DBGET integrated database retrieval system