KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_004700
Entry
PCC21_004700      CDS       T02320                                 

Definition
(GenBank) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PCC21_004700
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFR01873
Position
complement(523320..523799)
AA seq 159 aa
MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYATNYDLSRDRHVNHHPFS
VTKVVDKSTPLVLTSIANNELLEIELRYYRTSASGTQENYMTITLRDASIVNISNQNPNS
LTHNDMQPFETLSLRYESITCQHNIAGTSGYSILTENMY
NT seq 480 nt   +upstreamnt  +downstreamnt
atggctaattctattttcatgaagatcaccggaaaaattcagggactgatatctgaaggg
tgtttaagtatcgattctgtaggaaataaacatatctctggtcacgaagatgaaattttt
gtttatgccacaaattacgacctatcaagagatcgacacgtcaatcatcatcccttttct
gtgaccaaagtcgttgataagtctacaccgttagtcctaactagcatcgctaataatgaa
ctgctggaaattgagttgagatattaccgcacctccgccagcgggacgcaagagaactac
atgacaatcacattaagggatgcctctattgtcaatatctctaatcagaaccccaactca
ttgacacataacgatatgcagccatttgaaaccctgagcctgcgttatgaaagcattacc
tgccaacacaatattgcagggacatcgggatacagcatattaactgaaaatatgtactga

DBGET integrated database retrieval system