KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_005610Help
Entry
PCC21_005610      CDS       T02320                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00010  Glycolysis / Gluconeogenesis
pcc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_005610
   00500 Starch and sucrose metabolism
    PCC21_005610
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PCC21_005610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 DUF4038 Cellulase
Motif
Other DBs
NCBI-ProteinID: AFR01964
UniProt: J7KTW2
Position
complement(626768..628156)
Genome map
AA seq 462 aa AA seqDB search
MKAFPDGFLWGGSVAANQVEGAWNEDGKGVSTSDLQLKGVHGPVTERDESISCIKDQAID
FYHQYPQDIQLFAEMGFKVLRTSIAWTRIYPEGDEAEPCEAGLAFYDRLFDEMAKHQIQP
LITLSHYEMPYGLVKKLGGWGNRAVIDHFEKYARTVFSRYKDKVKHWLTFNEINMALHSP
FTGIGLSGEPSKQEIYQAIHHQLVASARAVKACHDIIPDAKIGNMLLGAVRYPMTCHPKD
VLEAQSKNREWLFFGDVQVRGTYPAWIQRYFRENGIELTITAQDKDDLSHTVDFVSFSYY
MSGCATFEPEKYQSSRGNIIRLIPNPHLEASEWGWQIDPEGLRFLLNELYDRYQKPLFIV
ENGLGARDVVEEDGSIHDSYRIDYLRRHLIQVREAIDDGVELLGYTSWGPIDLVSAGTAQ
MSKRYGFIHVDRDDDGKGTLERRRKDSFYWYQDVINSNGKSL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattccccgacggatttttatggggcggttcagtcgcagcaaaccaggttgaa
ggcgcatggaatgaagacggtaaaggtgtgtcgacctccgatcttcagctaaaaggcgtg
catggtccggtgacggaacgcgatgagagcattagctgcatcaaagatcaggccatcgat
ttttatcatcaatacccgcaggatattcagctgtttgccgaaatggggttcaaggtgtta
cgcacctcgattgcctggacgcgcatttacccagaaggtgatgaagcggaaccttgtgaa
gccggtctggccttctacgatcgcctgttcgatgaaatggcaaagcaccagattcagccg
ctgattacgctgtcgcactatgaaatgccttacgggctggtgaaaaagctggggggctgg
ggcaaccgtgccgtcatcgaccattttgagaagtacgcccgtaccgttttcagccgctac
aaagacaaggtgaagcactggctgaccttcaatgaaatcaatatggcgctgcattcaccc
tttacgggcatcgggctgagtggcgaaccctcgaagcaggaaatttatcaggctattcac
caccagttggttgccagcgcacgcgcggtaaaagcctgtcacgacatcatcccggatgcc
aaaatcggcaacatgctattgggcgcggtacgctaccccatgacctgccatccgaaagat
gtactggaagcgcagagtaagaaccgtgaatggctgttcttcggcgatgtgcaggtacgc
ggcacctatccggcttggatccagcgctatttccgggaaaatggcatcgaacttaccatt
accgcgcaggataaagacgatctgagccacaccgtagactttgtctccttcagctattac
atgagcggctgcgcgaccttcgagccggagaaatatcagtcctcacgcggcaatatcatc
cgtctgattcctaacccacaccttgaggcctccgaatggggctggcagatcgaccccgaa
ggcctgcgcttcctgctgaacgagctgtatgaccgctatcagaagccgctgttcatcgtg
gaaaacggtctgggtgcacgcgacgtggtggaagaggacggcagcattcacgacagttac
cgcattgattacctgcgtcgccatctgattcaggtacgtgaagccatcgacgatggcgtc
gaactgctgggctacaccagttggggaccaatcgatctggtcagcgcggggacggcgcag
atgtcaaaacgctacggctttattcatgtggatcgcgatgatgacggcaaaggcacactg
gagcgtcggcgcaaagacagcttctactggtatcaggatgtgattaacagcaacggaaaa
tcgctgtaa

DBGET integrated database retrieval system