KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_007540Help
Entry
PCC21_007540      CDS       T02320                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00561  Glycerolipid metabolism
pcc00640  Propanoate metabolism
pcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PCC21_007540
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PCC21_007540
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PCC21_007540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Polysacc_deac_2 CNTF
Motif
Other DBs
NCBI-ProteinID: AFR02157
Position
complement(853575..854672)
Genome map
AA seq 365 aa AA seqDB search
MSHFIFSSPGKYVQGRGVLDLLGEQLKPLGAKAFLMADSTVWDIIGQRVDASLKQASIGH
HYERFNGEASSNEITRLAKLARDAGTNIVVGLGGGKTLDTAKAVADELKHNVAIVPTVAS
TDAPCSALSVIYTDDGVFESYRFYNKNPDLVLVDTAVCAQAPARLFASGIADGLATFVEA
QAVQRSHALSMVGGKPTLAGMAIAETCETTLLTYGYSAYKAVEKGMVTPAVESVVEANTL
LSGLGFENGGLAGAHAIHNGFTAIKGDIHHLTHGEKVAYGTLTHMVLEQRPDEEIAHYIR
FYRAINMPTLLKDLHLENEPFENLLKVGELACSDADTLKNLDSRLTAEDVAHAIVAVDAF
SKTIA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatttcattttctcttcacctggaaaatatgttcagggtcgcggcgtgctggat
ctactgggcgaacagctcaagccgctgggtgcgaaagcgtttctgatggcggacagcacg
gtgtgggacatcatcggccagcgcgtcgatgcctcactcaaacaggcgagcatcggacac
cattacgagcgttttaacggtgaggcttccagcaacgaaatcacccgtcttgccaagctg
gcgcgtgacgcagggacgaatatcgtcgttggattaggtggcggcaaaacgctggatacg
gcaaaagccgtcgccgatgagctaaaacacaacgtcgctatcgtcccaaccgtggcctca
acggatgcaccgtgcagcgcgctgtccgtcatctataccgatgacggcgtgtttgaatcc
taccgtttttacaataagaaccccgatctggtgctggtcgataccgccgtgtgtgcgcag
gcacccgcgcgtctgttcgcctccggcattgccgatggcctggccacgtttgtcgaagca
caggccgttcagcgctctcacgccctctccatggtgggcggtaaacccacgctggcgggc
atggcaattgccgaaacctgcgaaacaacgctgctaacctacggctacagcgcctataaa
gccgtggaaaaaggcatggtcacaccggcggtagaatccgtggttgaagccaacacgctg
ctttccggtctgggctttgagaacggcgggctggctggcgcgcacgccatccacaacggc
tttaccgcgatcaaaggcgacatccaccacctcacacacggggaaaaagttgcctacggc
acgttaacgcatatggtgctggagcagcgacctgatgaggaaatcgcccactacatccgc
ttctaccgcgccatcaacatgccgactctgctaaaagatctgcatctggaaaatgagccg
tttgagaatctgctcaaagtgggtgaactggcgtgcagcgacgccgatacgttgaaaaat
ctggacagcaggctaacggccgaagacgtcgcccacgcgattgttgccgtcgatgcgttc
agtaaaaccatcgcttaa

DBGET integrated database retrieval system