KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_012320Help
Entry
PCC21_012320      CDS       T02320                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00520  Amino sugar and nucleotide sugar metabolism
pcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PCC21_012320
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     PCC21_012320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AFR02635
Position
complement(1408916..1410061)
Genome map
AA seq 381 aa AA seqDB search
MYALTHSRIFTGHQILDNHAVVIADGLIERVCPLAELPAGIEQHDLSGAFLAPGFIDLQL
NGCGGVQFNDSLDTISVKTLEIMQQANERSGCTSFLPTLITSSDAFMKHSIDVMRDWLAQ
NKHQALGLHLEGPWLNVLKKGTHDPAFIRKPTQELVDFLCANADAITKITLAPEEVEPSV
IRQLTAAGIIVSAGHSNATWEQAKRGFAAGIRFATHLFNAMPYLTGREPGLVGAIYDAPE
VYCGIIADGRHVDWANIRNSKRIKGDKLVLVTDATAPAGADIDQFIFAGKTIYYRDGICV
DEHGTLSGSALTMIDAVRNSVEDAGIALDEAIRMATLYPARAIGVDKQLGSIESGKVANL
TVFDRDYHILKTFVNGNPVWG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcattaacccatagccggatcttcaccggccatcagattctggataatcacgcc
gtcgtgattgctgatgggctgatcgaacgagtctgcccacttgccgagcttcctgccggc
attgaacaacacgacctgagcggtgcgttcctcgccccgggttttatcgatctccagttg
aacggctgcggcggcgtgcagttcaacgactcgctggacacgatctccgtcaagacgctg
gagatcatgcagcaggcgaacgagcgttcaggttgtaccagttttttacctacgctgatt
acctccagcgatgcatttatgaagcacagcatcgatgtgatgagagactggctggcgcag
aataagcatcaggcgctagggctgcatctcgaaggtccgtggctgaatgtactcaagaaa
ggcacacatgaccctgcctttattcgcaaaccaacgcaggaactcgtcgacttcctgtgc
gccaacgcggatgccattacgaaaatcacgctggcaccggaagaagtcgaaccgtcggtt
atccgccagctaacagcggcgggcattatcgtctctgccgggcattccaacgccacctgg
gaacaggcgaagcggggttttgccgctggtattcgtttcgctacccacctgttcaacgcc
atgccgtatctgacaggccgcgaacccggattggtcggcgcgatttacgacgccccggaa
gtctattgcggtattatcgcggatggacgacacgttgactgggccaatattcgcaacagt
aaacgtatcaagggcgataaattggtgctggtgaccgacgccacggcaccggccggcgcg
gatattgaccagttcatttttgctggtaaaaccatatactaccgtgatggtatttgtgtc
gatgaacacggcaccctgagcggttcggcactgacgatgatcgacgccgtacgtaatagc
gtcgaagacgcgggcatcgcgctggatgaggcgattcggatggcaacgctctaccctgcg
cgcgccatcggcgtggataagcagttaggcagtattgaaagcggtaaagtggccaacctg
accgtctttgaccgtgactatcacattctcaagacgtttgttaacggtaatcctgtttgg
ggataa

DBGET integrated database retrieval system