KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020170Help
Entry
PCC21_020170      CDS       T02320                                 

Definition
(GenBank) putative 6-phosphofructokinase isozyme II
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00010  Glycolysis / Gluconeogenesis
pcc00030  Pentose phosphate pathway
pcc00051  Fructose and mannose metabolism
pcc00052  Galactose metabolism
pcc00680  Methane metabolism
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01130  Biosynthesis of antibiotics
pcc01200  Carbon metabolism
pcc01230  Biosynthesis of amino acids
pcc03018  RNA degradation
Module
pcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_020170
   00030 Pentose phosphate pathway
    PCC21_020170
   00051 Fructose and mannose metabolism
    PCC21_020170
   00052 Galactose metabolism
    PCC21_020170
  Energy metabolism
   00680 Methane metabolism
    PCC21_020170
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PCC21_020170
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PCC21_020170
Protein phosphatases and associated proteins [BR:pcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PCC21_020170
Messenger RNA biogenesis [BR:pcc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PCC21_020170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat DUF1357_C
Motif
Other DBs
NCBI-ProteinID: AFR03420
UniProt: J7KW54
Position
complement(2272669..2273649)
Genome map
AA seq 326 aa AA seqDB search
MKIGLVISGGDVSGINNFIFQVNRMTASDIVIFDGGINGLIDNCCKVLTRRDLVDYSISA
MPLITSGRKTGKCRKTDYEQIVKNIQKQKLDALIMAGGDGSFQFLKKLSHYGVHCYGVGM
TIDNDISGNSYTIGFSTACEQVMSEVEKLRNTGRGLQGRVFMIELLGGYCGELTLQAALK
SNADIALIPESPWDIDKLSQCIREKIAEQNSVIILCSEGYTHEYTPGFQGAIDTIIKKLE
HKIGIRIRKTILGYGLRNGAPTGEEIIQGTLLAEEVVRCINAGLTNKIIIINNNNKAIPI
DLEDSERRLVDVDSHFYKLAKAHHLI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggattagtcattagcggcggcgacgttagcggaataaataacttcatcttt
caggtgaacagaatgactgcctctgacatcgtcattttcgatggtggaattaatggcctt
atcgataactgctgtaaagtcctcactcgccgcgatttagtggattattccatctcggca
atgcccctgattacttcagggagaaaaaccggaaaatgtagaaaaacagactatgagcaa
atcgtcaaaaacattcaaaaacaaaaactcgacgcgctcattatggctggcggagatggc
tcattccaatttttaaaaaaactcagtcactatggcgttcattgctatggcgtaggcatg
acgattgataatgacatttcagggaatagctatacgattggtttttctaccgcctgcgag
caggtaatgagtgaagtagagaaattacgaaatacaggccggggattacaaggccgggtg
ttcatgattgaattactcggtggatattgtggcgaattaaccttgcaggcggcattaaag
agcaatgcagacatcgcactcattccagaatcaccgtgggatattgataaattatcacaa
tgtattcgggagaaaatcgcagaacaaaacagcgtgatcattttatgctctgaaggctat
acccatgagtatactcctggctttcagggcgctatcgataccattatcaagaaactagag
cataagattggcatccgtatccgaaaaaccattttgggatatggtttacgaaatggcgcg
cccaccggggaagaaattattcagggcaccctattagcagaagaagtggttcggtgtatt
aacgccggactaaccaataaaattatcattatcaataataacaacaaggctattcctatc
gacctggaggattccgaacgacgtttggttgatgtcgacagtcacttttataagctcgcg
aaagcccatcaccttatatga

DBGET integrated database retrieval system