KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_029640Help
Entry
PCC21_029640      CDS       T02320                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00520  Amino sugar and nucleotide sugar metabolism
pcc01100  Metabolic pathways
pcc01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pcc_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PCC21_029640
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PCC21_029640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pcc01005]
    PCC21_029640
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     PCC21_029640
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     PCC21_029640
Lipopolysaccharide biosynthesis proteins [BR:pcc01005]
 Unusual sugar
  PCC21_029640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_4 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AFR04367
Position
complement(3330801..3332834)
Genome map
AA seq 677 aa AA seqDB search
MKAIVFAYHDIGCVGLEALKLAGYEIQAVFTHSDAPGENHFYASVAKAAAEMDVPVFAPE
DVNHPLWVNRIRELAPDVIFSFYYRTLLSDDILQLPSFGAFNLHGSLLPRYRGRAPVNWV
LVNGETQTGVTLHKMVSRADAGDIVAQSVVAIDEEDTALTLHGKCRTAAAALLAQQLPLI
RSREITLTQQDDSRASYFGRRTAADGLIDWQKSAREINNLIRAVTEPYPGAFTFLGERKV
IIWRARVVKVNRVKSNDVRANGVKQEPGAIISTSPLVVSCGEDALEIVSGQSEAGLYMSG
SRLAAEMGMVPQAKLGNLASRVQRRRTRVLILGVNGFIGNHLTERLLRDDRYEIYGLDIS
SDAIARFLGDPRFHFVEGDISIHNEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELD
FEENLKIVRDCVRYNKRIVFPSTSEVYGMCDDKEFDEDTSRLIVGPINKQRWIYSVSKQL
LDRVIWAYGAKNGLRFTLFRPFNWMGPRLDTLDAARIGSSRAITQLILNLVEGSPIKLVD
GGAQKRCFTDIHDGIEALFRIIENRNGQCDGQIINIGNPHNEASIRELGEMLLTSFNAHP
LRDRFPPFAGFIDVESSSYYGKGYQDVEHRTPSIRNAKRLLAWEPTVKMDQTVAETLDYF
LRTVDPLHTADAKDAQG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatcgtatttgcctaccatgatatcggctgtgtcggccttgaggcgttaaag
ctcgcgggctatgagattcaggcggtgttcacgcacagcgatgcgccgggtgagaaccac
ttctacgcttcagtggcgaaagcggctgccgagatggacgtgccggtgtttgcgccggaa
gacgttaaccatccgctctgggtgaaccgcattcgggaactggcaccggatgttattttt
tccttctattaccgcacgctattaagcgatgacattctccagctaccgtcgtttggcgca
tttaatctgcacggttcactgctgccgcgctatcggggacgtgcgccggtgaattgggtg
ttggtgaacggcgaaacacagacgggcgtgacgctgcacaagatggtgtctcgcgctgat
gccggtgatatcgtcgcccagtccgtagtggcgattgatgaggaagacaccgcgctgacg
ctgcatggcaaatgtcgtaccgccgctgccgcgctgctggcgcagcaactgccgctgatt
cgctcacgtgagattacgctgacgcagcaggatgacagccgggccagctatttcggacgt
cgcacggcggcagacgggctgatcgactggcaaaagagcgcccgtgagattaacaacctg
atccgcgcggtgacggaaccgtatccgggcgcgtttacgttcctcggtgagcgtaaagtg
attatctggcgcgctcgtgtagtgaaggttaatcgcgttaaaagcaacgatgtgagagcc
aatggggtgaagcaggaaccgggcgcgatcatctcgacgtcgccgctggtggtgtcttgc
ggtgaggatgcgcttgagatcgtcagcgggcagagtgaagccgggctgtatatgtcaggc
agccggctggcggcggaaatgggcatggtgccacaggcgaaactgggtaacctcgccagc
cgtgtacaacgacgccgcacgcgcgtgctgatcctcggcgtgaatggttttatcggtaac
cacctgaccgaacgcctgctgcgggacgatcgctatgagatctacgggctggatatcagc
tcggatgccatcgcccgttttcttggcgatccgcgttttcattttgtggaaggcgatatc
agcattcataacgaatggatcgaataccacatcaagaaatgcgatgtcattctgccgctg
gtggcgattgccacgcctatcgaatacacccgtaacccactgcgcgtgtttgaactggac
tttgaagaaaacctgaaaatcgtacgcgactgcgtacgctacaacaaacgcattgtcttc
ccgtccacctctgaagtgtacggcatgtgtgatgacaaagagtttgatgaagatacctcg
cgcctgattgtcgggccgatcaataagcagcgctggatctactccgtgtccaagcaactg
ctggatcgggtgatctgggcgtacggtgcgaaaaacggcctgcgctttacgctgttccgt
ccgtttaactggatgggaccgcgtctggatacgctggacgcggcacgcatcggcagctcc
cgggcgattacccaactgatcctcaatctggtggaaggatcgccgatcaagctggtggat
ggcggagcgcagaagcgctgctttaccgacatccatgacggcattgaagcgctgttccgc
attattgaaaaccgcaacggccagtgtgacgggcagatcatcaatatcggtaatccgcat
aatgaagccagtatccgcgaattaggcgaaatgttgctgaccagctttaatgcgcatccg
ctgcgtgaccgtttcccgccgttcgccgggtttattgacgtggaaagtagcagctattac
ggcaaaggctatcaggatgtggagcaccgtacgccgagcattcgcaatgccaaacgcctg
ctggcatgggagccgacggtgaagatggatcaaaccgtcgcggaaacgctggactatttt
ctgcgtaccgttgatcccctgcacaccgctgacgccaaggatgcgcagggatga

DBGET integrated database retrieval system