KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_032290Help
Entry
PCC21_032290      CDS       T02320                                 

Definition
(GenBank) IcmF-related protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PCC21_032290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pcc02044]
    PCC21_032290
Secretion system [BR:pcc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PCC21_032290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C Wzy_C_2 Alfin
Motif
Other DBs
NCBI-ProteinID: AFR04632
Position
complement(3652224..3655721)
Genome map
AA seq 1165 aa AA seqDB search
MFKTIITFLRKQLPKLKLSWLLLGVLLWVVVLVLAWWLGPRLTVGESRPLQGIWGRVVFT
LVWLWLAFSYSAWLVWRRVQQMRAERHEQQVIEQDPLQVYVDSQQTFLDRWLEAFQTQLG
KRALYAMPWYLTIGLAGSGKSSLIHRANPANKMNPKLDAELRDVAAGQQVSSWVGESAVI
WDPSGQLLAQPELEGDSLGQRHARLWQHLLQWLSENRRRQPLNGLVLTLDISWLAQAGVA
DRKAYAQVMRARMQEISVNINTRLPVYIALTRLDMLSGFDKVYRQLNREARQAVLGVTFT
PQASNSKGWLEELERFWDEWVTHLNDNLPDMLLTQSDRSVRNSLFSFVRQLAGVKDYVME
VLTETLATGEDRAFLIRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINPALRGESNTFF
VQRLFPDVIFPEASLAGENRLHSLYRRRRLSIGVGCMLLASLALIGSWHHFYRVNEEAGR
NVLTKAQAFIGTNELEGQQGYGYQQLPRLNLIRDATLSFGNYHERTPLLADLGLYQGDKI
GPHVEGTYLQMLNQRFLPAVMQGLLEDLNQAPANSEQKLTILRVMRMLDDASGRNKALVE
QFMAQRWQKAFPGQGNVQEQLMQHLDYALEHTDWHKAREQKDAVAISTFAPFNGPITLAQ
QELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDPVFSLRNDKAGSVPRLLTYPG
FSDYYLKQDKALLELTALDAWVLGQRERAQFSEADRREILRQVNDRYITDYINQWQKVLA
NIDVQTLDTPEQALDILTDITGNDQPFQRVLTTVSDNTRIRKLSDDDNDTAQSINTRTGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFAD
PVFALQQYARSLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYP
FDPSSNKDVPLSEMEMFFMTGGTLDSFYQTNLKAMMESGMLEEGMASPLQAELVKQLERA
TRIRQTLFNAQGSLEVHFVLEPLELTANKRRSVLNLDGQLLEYSHGRRQKTPLVWPNSMR
DGAESKLTLVPDDRERSPRSLSFSGPWAMFRLINSDQLTQVNENTFDVRFSLENGAMTYR
VYTDASHNPFAGGLFSQFTLPDSLY
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacaatcataacctttctacgcaagcagttacctaaactgaaactctcctgg
ttacttttgggcgtgctgctgtgggtcgtcgtgttggttctggcctggtggctggggccg
cgtttgacggtgggcgagtcgcgtccgttgcagggaatctggggccgcgtggtgttcacg
ctggtttggctgtggctggcgttttcctacagcgcctggctggtctggcgtcgcgtgcag
cagatgcgggcggagcgtcatgagcagcaggtgattgaacaggatcccttgcaggtgtat
gtcgacagccagcaaacgtttctcgaccgctggctggaggcgtttcagacccagttgggt
aaacgcgcgctgtacgcgatgccctggtatctgacgattggtctggctggcagcgggaaa
agtagcctgatccatcgcgctaatccggcaaacaaaatgaatccgaagctggatgcggag
ctgcgagacgtggcggcaggccagcaggtgagcagttgggtcggcgaatccgcggtgatt
tgggacccaagcggacagctacttgcccagcctgagctggaaggcgattcgctcggacaa
cgtcatgctcgactgtggcagcacctgttgcagtggctcagtgaaaaccgccgccgccag
ccgctcaacggtctggtgctcacgctggatatctcctggctggcgcaggctggcgtcgcc
gatcgcaaagcttacgcgcaggtgatgcgcgcccgcatgcaggagatttccgtcaacatc
aatacgcgcttaccggtatatatcgcgctgacccggctggatatgctgagtggcttcgat
aaggtctatcgccagttgaaccgcgaggcgcgtcaggccgtattaggggtgacgtttacg
ccgcaggcgagcaacagcaaaggctggttagaagagctggagcgcttctgggacgagtgg
gtcacgcacctgaatgacaacctgccggatatgctgctgacgcaatccgacagaagcgtg
cgcaattcgctgttctcgttcgttcgccaactggctggggtgaaagattatgtgatggaa
gtgctgacggaaacgttagcgacgggcgaggatcgcgcgttcctgatccgcggcgtctac
gtcagttctgtctaccaacaaggggtgccgttcgatgcctttgcgcaatcggcttcccgc
cgctatcaactgccagagccgattaaccctgcgctgcgcggtgaatccaatacgttcttt
gtgcaacgtctcttccctgacgtcattttccctgaggccagtctggcgggggaaaaccgg
ctgcatagcctctatcgtcggcgtcggctgagtatcggcgtgggctgcatgttgctcgcc
agtctggcgctgattggcagctggcaccatttctatcgggtcaatgaagaggcgggacgt
aacgtcctgacaaaagcacaggcctttatcggcaccaatgagctggaaggccagcagggt
tacggctatcagcagttgccgcgtctgaatttgattcgcgatgcgaccttatcctttggt
aattaccacgagcgcacgccgctgctggccgatcttggtctgtatcagggcgacaagatt
ggccctcatgttgaaggcacctatctgcaaatgctgaatcagcgctttctcccggcggtg
atgcaagggcttctggaagatctgaatcaggcaccggccaatagtgagcaaaaactgacg
attctgcgcgtgatgcggatgctggatgatgcgtcagggcgcaataaagcgctggtcgaa
cagtttatggcgcagcgctggcagaaggcatttcccggacagggcaacgtgcaggaacag
ctgatgcagcatctggattatgcccttgagcacaccgactggcacaaggctcgtgagcag
aaagacgcggtagcgatcagcacgttcgcgccatttaatggaccgattacgctggcccag
caggaactgagcaagctgccgatgtatcagcgcgtttaccagagtctggtgatgaaggcg
acacaggtgctgccgccggatttagcgattcgtgacgaagtcgggccgacctttgacccg
gtgttttctctgcgtaatgacaaagcgggaagtgtgcctcggctgctgacgtatcccggc
tttagtgattattacctcaagcaggacaaagcgctgttagagctgacggcactggacgcc
tgggtgctgggacagcgtgagcgtgcgcagttcagcgaggccgatcggcgggaaattctg
cgccaggtgaatgaccgctacattacggattacatcaaccagtggcagaaagtgctggcg
aacattgatgtgcagacgctcgatacgccggagcaggcgctcgacattctcacggatatt
actggcaacgatcagccttttcagcgcgtgctgactacggtcagtgacaacacccgtatc
cgtaagctatccgatgatgataacgacacggcgcagagtattaacacgcgtactggtcgt
ccgtttatgaccatcaatgcggcgctgagcggacgcggtgagcaggggccgctggtgcaa
gaggtcaatcagaagctgaccgatctctatcactatctcgatcagatcgttaacgcaacc
gatccgggacaggcggcgttgaaagcggtgcaggcgcggcagggaaataaatttgccgat
ccggtattcgccttacagcaatacgcccgcagccttcccgcgccgctggatcgctgggta
ggacaattagccggagagagcgcgagtctggtgaccgggctggcgatgtcgtcgctgaat
caggaatggctggataaggtcgtcacgccattcaatgagaagctggcagatcgttatccc
ttcgacccgtcatcgaacaaggatgtgccgctatcggaaatggaaatgttcttcatgact
ggcgggacgctggacagcttctatcaaaccaacctcaaggcgatgatggagagcggcatg
ctggaagaaggcatggcatcgcctctgcaggctgagctggtgaaacagcttgaacgcgct
acccgcatccgccagaccctgtttaatgcacagggcagcctggaagtgcatttcgttctg
gagccgctggaactgacggcgaacaagcgccgcagcgtgctgaatctggacggacaactg
ctggaatacagccacggtcgtcgccagaaaacgccgctggtgtggccaaacagtatgcgc
gacggggctgagagcaagctgacactggtgccggacgatcgtgagcgttctccgcgtagc
ctgagctttagcggaccgtgggcgatgttccgcttaatcaatagcgatcagctgactcag
gtgaatgagaacaccttcgacgtgcgcttctcgctggagaacggggcgatgacctatcgc
gtgtataccgatgccagccataacccgtttgccggtggtctgttcagccagttcacgctg
cctgactcgctttattaa

DBGET integrated database retrieval system