KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_032350Help
Entry
PCC21_032350      CDS       T02320                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pcc02044]
    PCC21_032350
Secretion system [BR:pcc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PCC21_032350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AFR04638
Position
complement(3662686..3664023)
Genome map
AA seq 445 aa AA seqDB search
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRI
ALVNASGVMPDGTVFNIPGDDALPLPLEITDVALANQKVYLALPLAVNGVSEVGQPGQGI
ASRLQSHRHDVRDLHSDGGDIVSLEVGKVSLRLMLDRDDRSAYASLAIANILDKRPDGGL
ILDPNFMPCSISVTAIPTLKRFLGESAGLVAERARSLAQRIAAPGQQGVADVAEFMMLQL
LNRAQPKLSHLARLGTLHPERLHETLVELCGELMTFTDESRLPPEFPAYRHEHQQASFEP
LMMSLRQALSTVLSPRAVSIQLKKQPYGVMVAMVGDAELMASAEFVLAVRARMPQEHLRK
QLLQQTKIASSEKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQVLVS
GNTLAFHIAGEFPELDMQLWAIRGQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtcgcaatcgcattatctggcgggaaggtctgttcattaaaccgcagcatttt
caacaacagcaaagacacaccgattacgcactgcacgcgcgtctcagcgccctcagtgac
tatttctatggcttgcagtcgctggcgattaatgaggaatacctcaattttggccgcatc
gcgctggttaacgccagcggcgtgatgccggacggcactgtgttcaatattccgggcgac
gacgccctgccgctgccgttggagattaccgacgtcgcgctggcaaaccagaaagtgtat
ctggcgctgccgctggcggtaaatggcgtcagtgaagtcggtcagccggggcaggggatc
gccagccgcctgcaatcgcaccggcatgacgtgcgcgacctgcacagcgacggcggcgat
atcgtttctctggaagtcggaaaagtcagcctgcgcctgatgctcgatcgtgacgatcgc
agcgcctatgcctcgctggcgattgccaacattctggataaacgccctgacggcggcttg
attctggatcctaacttcatgccgtgcagtatcagcgttaccgcgatccctaccttaaaa
cgctttttgggggaatccgccggtctggtggcggaacgcgcgcgcagtctggcgcagcgt
attgccgcaccgggacagcagggcgtcgcggacgtggccgaatttatgatgctgcaattg
cttaaccgcgcgcagcccaagctgtcgcatctggcgcgccttggcacgttgcaccctgaa
cgcctgcacgaaacgctggttgagctgtgtggcgagctgatgacgtttaccgatgagtcg
cgtctgccgcctgaattccccgcctatcgtcacgaacaccagcaggccagctttgagccg
ctgatgatgtcactgcgtcaggcgctgagcaccgtgctgtcgccgcgcgccgtctccatc
caactgaagaaacagccgtatggcgtgatggtggcgatggttggcgatgcggaattgatg
gccagcgccgagtttgtcctggcggtgcgtgcgcgtatgccgcaggagcatctgcgtaaa
cagctgctgcaacaaacgaagatcgcctccagcgagaagatccgcgaactgatcagcctg
caattgccgggtatcccgctgctgccgctgccggttgcgccgcgccagctgccttatcac
gcgggctacagctatttccaactggatagacaaagccccgcctggcaggtgctggtgtct
ggcaacacgctggcgttccacattgctggcgaattcccggaactggatatgcagctttgg
gctatccgtgggcagtag

DBGET integrated database retrieval system