KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_032420
Entry
PCC21_032420      CDS       T02320                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pcc02044]
    PCC21_032420
Secretion system [BR:pcc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PCC21_032420
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFR04645
Position
complement(3670574..3671077)
AA seq 167 aa
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSI
DKNNFTSVMKEANLELNFSVPNRLEEESQDELPVKLSIGGLNDFSPDRIAQQVPELRKLL
DLREALVALKGPLGNIPSFRNRLQDLLSSEEAREQLLKELDLVKPAE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcaaaaggaactgatggtgcatctgtcgcaccaaaggaacgtattaatatcaaatat
gttccggccactggtggtcagcaggcggaaatagaattgccgttgacgctgatgatcgtg
ggaaatatgaaagggcgcacagaggaaacgccgatcgaagaacgtcagaccgtatcgatc
gataagaacaactttacctcagtgatgaaagaagcaaatctggaattgaatttcagtgtg
ccaaaccgccttgaagaagaaagccaggacgagctgccagtgaaactgagcatcggcggt
ctgaatgatttctcccctgaccgcattgcccaacaggtgcctgaattacgtaagttgctt
gatttacgtgaagcactggtggcgctgaaaggccccctcggcaatattccctcattccgt
aatcgtttgcaggatctgttgtccagcgaagaagccagagagcagcttttgaaagagctc
gatctggtcaaacccgccgaataa

DBGET integrated database retrieval system