KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_037680Help
Entry
PCC21_037680      CDS       T02320                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00630  Glyoxylate and dicarboxylate metabolism
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01200  Carbon metabolism
Module
pcc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PCC21_037680
Enzymes [BR:pcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PCC21_037680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AFR05171
UniProt: J7KXB6
Position
complement(4286388..4287695)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQVQHIEKEWKTARWEGITRPYSAEDVINLRGSVNPEYTLAQLGAAKLWNLLHG
DSRKGYVNCLGALTGGQALQQVKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPA
VIERINNTFRRADQIQWANRIEPGDKRHTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASAKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDEYDRDFITGERTVEGFYRTRAGIEQAISRGLAYAPYADLVWCETSTPDLSLAR
RFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDSTIARFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMRHYVEKVQQPEFEAIKDGYTFSSHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctcgtacccaacaagtccagcatatcgaaaaagagtggaaaaccgcccgc
tgggaagggattacgcgcccctatagcgcagaagatgtgattaatctaaggggatcggtg
aacccggaatacacgctcgcgcaactcggcgcggcaaagctatggaacctgctgcatggt
gactctcgcaaaggctatgtgaattgcctgggcgcgctgacaggagggcaggctttacag
caggtgaaagcgggcatcgaagcgatttacctttccggctggcaggtagcggcggatgcc
aatctggcgtccagcatgtatcccgatcagtcgctctacccggcgaactccgtacctgcg
gtgattgaacgcatcaataatacgtttcggcgtgccgatcagattcaatgggcgaaccgc
attgaaccgggcgacaagcgccataccgactactttctgccgattgtggcggatgcggag
gcggggtttggcggcgtgttgaatgcgtttgagctgatgaaatcgatgattgaagcaggt
gcagcagcagttcactttgaggatcagctggcatcagcgaagaaatgcgggcacatgggc
ggcaaggtgctggtaccgacgcaggaggcgattcagaaactggttgctgcccgtctggcg
gcggatgtcttgggcgtgccgaccttactggttgcgcgaaccgatgcggatgcagcggat
ctgctgacttccgattgcgatgaatatgaccgtgatttcatcactggagaacgtacggtg
gaaggcttctatcgcacgcgagccgggatcgagcaggcaatcagccgcggtctggcctac
gcaccgtatgccgatttggtgtggtgcgaaacctcaacgccggatttatcgctggcgcgt
cgttttgctgaggctatccacgcgaagttccccggtaagctgctggcgtacaactgctca
ccttcctttaactggaagaagaatctggatgacagcacgatcgcacgttttcaggatgag
ctgtcggcgatgggctataagtaccaattcattacgctggccggcatccacagcatgtgg
ttcaacatgtttgatctggcgcacgcctatgcgcagggcgaagggatgaggcactacgta
gaaaaagtgcagcagcctgaatttgaggcgattaaagacggctataccttctcatcgcat
cagcaggaagtgggtaccggctacttcgataaggtaacgaacatcattcagggaggcgag
tcttcagtgacggcgctgacgggatcgacggaagaacagcagttctga

DBGET integrated database retrieval system