KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_041390
Entry
PCC21_041390      CDS       T02320                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PCC21_041390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pcc02044]
    PCC21_041390
Secretion system [BR:pcc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PCC21_041390
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFR05542
Position
4701775..4702293
AA seq 172 aa
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDATI
VDVNCQMPHCQDPAKLDYTQLIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgctatatcagcatcgaaggtaaaacgcagggcaacatcaccgcgggt
gctttcacttctgattctgtcggcaacatctatgtggaaggccacgaagacgaaatgctg
gttcaggaattcaaacacatcgtcaccgtaccgaccgacccacagtctggtcagccgtcc
ggccaacgtgtacacaaaccgttcaaattcaccgtcgcgctgaacaaagcggttccactg
atgtacaacgccctggcttccggcgaaatgctgccgaccgtgaccctgaaatggtaccgc
acgtcggttgaaggtaagcaagagcactttttctctaccgtgctgaccgatgccaccatc
gttgacgttaactgccagatgccacactgccaggatccggcgaagctggactacacccag
ctgatcgaagtatcgctggcctaccgcaaaatcgattgggaacacaccgttgcaggaacc
tctggttccgatgactggcgtgcgccggtcgaagcgtaa

DBGET integrated database retrieval system