KEGG   Mixta calida: C2E16_09800Help
Entry
C2E16_09800       CDS       T05419                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcd  Mixta calida
Pathway
pcd00480  Glutathione metabolism
pcd00590  Arachidonic acid metabolism
pcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C2E16_09800
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2E16_09800
Enzymes [BR:pcd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C2E16_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AUY25167
Position
2069019..2069564
Genome map
AA seq 181 aa AA seqDB search
MSIYETELVMLDGTRTTLGQWKGDVLLIVNVASECGLTPQYEELENLQRAWNKSGFNVLG
FPCNAFLGQEPGSNEEIQQFCSTRYGVTFPMFSKIEVNGPNRHPLYQQLIAARPEAVEPE
NSGFYERMISKGRGPKEKGDILWNFEKFLVGRDGEVVQRFAPDMTPEDPIVMESIKLALA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttacgaaactgagctggttatgctggatggcacacgtaccacgctgggccaa
tggaaaggggatgtgctgttgattgttaacgtcgcctcagagtgcggcctgacgccgcag
tatgaagaactggaaaacctgcagcgcgcctggaacaaatccggctttaacgtgctgggc
tttccctgcaacgcgtttcttggccaggagccgggcagcaacgaagagatccagcagttt
tgcagcacccgttacggcgtgacctttccgatgttcagcaaaatcgaagtcaacggcccc
aaccggcatccgctttaccagcagctgatcgcggcgcgcccggaagcggtggagccggaa
aacagcggcttctatgagcgcatgataagcaaaggtcgggggccgaaagagaagggcgac
atcctgtggaatttcgagaagttccttgtcggtcgtgacggcgaagtggtgcagcgcttt
gcgccggatatgacgccggaagatccgatcgtgatggaaagcattaagctcgctctggcg
aaatag

DBGET integrated database retrieval system