KEGG   Mixta calida: C2E16_14300Help
Entry
C2E16_14300       CDS       T05419                                 

Definition
(GenBank) phosphotransferase RcsD
  KO
K07676  two-component system, NarL family, sensor histidine kinase RcsD [EC:2.7.13.3]
Organism
pcd  Mixta calida
Pathway
pcd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C2E16_14300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcd01001]
    C2E16_14300
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pcd02022]
    C2E16_14300
Enzymes [BR:pcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C2E16_14300
Protein kinases [BR:pcd01001]
 Histidine kinases
  NarL family
   C2E16_14300
Two-component system [BR:pcd02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   C2E16_14300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsD_ABL HATPase_c Hpt HisKA Elf4
Motif
Other DBs
NCBI-ProteinID: AUY25967
Position
3007681..3010338
Genome map
AA seq 885 aa AA seqDB search
MMYKFPLSSSNVTRFFVMFILLLLLALGFMVHNAVNAWLMEKRYAMADITHAMQKRIDTY
RFATWQIYENLAASAAGSVPSASLQETRLRPDVYYLEKTRRKTEALIFGSHDSSTLDMTL
RMSNYLDTLWGAENSTWSMYFLNGQDNSLILISTLPLKDMATRYKESAISNIVEARRTEM
LQQANALDERESFSPLRRFAWQNDHYFTVRTTFNQPGHLATVVAFDMPINDLIPHNMPME
NFQLKQDATLTAPVESDDEMLNTRITFNNPNVEIAASLPSTPLQLIYRIPLSTLAWDTLR
NLMWPLLADLLLLLMSLAGLFLLRQQSLRPGENKSAELDSLRMLNEEIVASLPVGLLVYD
FASNRTIISNKIAEHLLPHLNLQKIVNMSDQHQGVLQATVNNEVYEIRHARSQHSPHTQL
FMMRDQDRELLVNKKLQKAQQVLDRNHQLRQQLMQNLGHALHRPLQEVVTQLQALSDASD
DAQALDALENSQALARLVDDIVLLNRLETHDWAPDASSFNLQELLDRLTLELLPLSRRKG
LTLLVRNHLNSDEMRFGDSRAIYKVLSTLLHYSLTTTSWGKISVEVDSPADRPDRLNIQI
VDTGAGLTRDELGNNDFPFLGETSGDRFGQASGLAFFLCRQLCKQMGGQLEIVARPEIGT
RYSILLHVPPEHQQQQEEKLLEDVTMLIDIAVDDIRKIVTHQLENWGAKCITPDERVAGL
THDILITDDPARLSGWSLLLTDNELGFTALNEQQYRVNFNLSSALQDALLQLIEKQLSQD
MSIMEEDDAEESAPMLSGGYYQLFVETVPEDVERLYTEASNRDYATLAQTAHRLKGVFAM
LNLAPGKELCEKLEQQIKTSDDLNIKNTTSDIDAYVNELLQQGNQ
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacaagtttcctttatcctccagcaacgttacgcgtttcttcgtcatgtttatc
ctgctgctgttgctggcgctgggctttatggtgcataacgcggttaatgcctggctgatg
gagaaacgctatgcgatggcggatatcactcatgcgatgcagaaacgcattgatacctat
cgtttcgccacctggcagatttatgagaatctggcggccagcgccgcgggcagcgtgccc
tcggccagcctgcaggagacgcgcctgcgtcccgacgtttactatctggaaaaaacgcgc
cgtaaaaccgaagcgctgattttcggttcgcacgacagcagcacgctggatatgacgctg
cgcatgtctaactatctggatacgctttggggcgcggaaaacagcacctggtcgatgtat
tttcttaacggacaggataacagcctgatcctgatctctaccctgccgctgaaagatatg
gcgacgcgctataaagagagcgccatcagcaatatcgtcgaggcgcgccgtaccgagatg
ttgcaacaggcgaacgcgctggatgagcgggaaagcttttcgccgctgcgccgtttcgcc
tggcaaaacgatcactactttaccgtgcgcaccacctttaatcagccgggtcatctcgcc
accgtggtggcgtttgatatgccgatcaacgatctgatcccgcacaatatgccaatggag
aatttccagctgaagcaggacgcgacgctgaccgctccggtggaaagcgacgacgagatg
ctgaatacccgcattacgtttaacaacccgaacgtggagatcgccgcgtcgctgcccagc
acgccgctacagctgatctaccgcattccgctcagcaccctcgcctgggatacgctgcgc
aacctgatgtggccgctgctggctgacctgctgttgctgctgatgtcgctggcggggctg
tttctgctgcgtcagcagtcgctgcggccgggcgaaaacaagagcgccgagctggattca
ctgcgcatgctcaatgaagagattgtcgccagcctgccggtcggtctgctggtctatgat
ttcgccagcaaccgcaccatcatcagcaacaaaatcgccgagcatctgctgccgcatctg
aatctgcaaaagatcgtcaatatgtccgatcagcatcagggcgtgttgcaggcgacggtg
aataacgaggtatatgagatccgtcacgcccgcagccaacattcgccgcatacgcagctg
tttatgatgcgcgatcaggatcgcgagctgttggtgaataagaagttacagaaggcgcag
caggtgctggatcgcaaccatcagctgcgtcagcagctgatgcaaaatctgggtcacgcg
ctgcatcgtccgttacaggaggtggtgacgcagctgcaggcattgagcgacgccagcgac
gacgcccaggcgctggacgcgctggaaaacagccaggcgctggcgcgtctggtggatgat
atcgtgctgctgaatcgtctggagacccacgactgggcgccggacgccagttcgtttaat
ttgcaggagcttctcgacaggctgacgctggagctgctgccgctgtcgcgccgcaaaggg
ctgacgctgctggtgcgcaaccatctgaacagcgacgagatgcgcttcggcgacagccgc
gccatctataaggtgctctctaccctgctgcactattcgctgaccaccaccagctggggc
aagatttcagtggaagtcgattcgcccgccgaccgtcccgatcggcttaatattcagatc
gtcgacaccggcgcggggctgacgcgcgatgagctgggcaataacgatttcccgttcctc
ggcgaaacctccggggatcgcttcggccaggcttcggggctcgcctttttcctctgccgc
cagctgtgcaaacagatgggcgggcagctggagatcgtggcgcggcctgaaatcggcacg
cgctacagcattctgctgcacgtgccgcctgaacatcaacagcagcaggaagagaagctg
ctggaagatgtcaccatgcttatcgacatcgccgtcgatgacatccgtaagatcgtgacc
catcagctggaaaactggggcgcgaagtgcattacgccggacgaacgcgtagccggcctg
acgcacgatatcctgatcaccgacgatccggcgcgcctttccggctggtcgctgttgctg
acggataatgaactgggctttaccgctctgaatgaacagcagtaccgggttaattttaac
ctcagtagcgctctgcaggacgcgctgttgcagctgattgagaagcaactctcacaggat
atgtcgatcatggaggaagatgacgcggaagagtccgccccaatgttaagcggcggttac
taccagctatttgtcgagacagtaccggaagatgttgagagactgtatactgaggcgtcg
aacagggattacgcgacgcttgctcagacggcacatcgcctgaaaggggtatttgccatg
ctaaatctggcgcccggcaaggagctttgtgaaaagctggaacagcaaattaaaacgagt
gacgatttaaacatcaaaaataccaccagtgacattgacgcctatgtcaacgaactgctg
cagcaaggtaaccaataa

DBGET integrated database retrieval system