KEGG   Mixta calida: C2E16_16815Help
Entry
C2E16_16815       CDS       T05419                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pcd  Mixta calida
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pcd03009]
    C2E16_16815
Enzymes [BR:pcd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     C2E16_16815
Ribosome biogenesis [BR:pcd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C2E16_16815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 Spt5-NGN MIT_C
Motif
Other DBs
NCBI-ProteinID: AUY26396
Position
complement(3519895..3520995)
Genome map
AA seq 366 aa AA seqDB search
MNKVLLYCRSGFEKECAAEITDKAAQRGVYGFARVKENAGYVLFECYEATDADKLARELP
FSELIFARQMVVAGELLRDLPPEDRISPIAGMLNGVVEKGGELRVEVPDTNEAKELLKFC
RKFTVPLRAALRQQNSLLNYESAKRPVIHVFFIASGHCYVGYSYPDNNSPFFMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLASGMYAVDLGACPGGWTYQLVKRSMMVHAVD
NGPMAPSLMDTGQVMHHREDGFKYRPTRSNISWLVCDMVEKPVRVANLMAEWLINGWCRE
AIFNLKLPMKKRYEEVSQNLTMIQEKLRENGINAQIQARQLYHDREEVTVHIRRIWGAAP
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgttgttgtactgccgctccggctttgaaaaagagtgcgcggcggaaatt
accgataaagcggcgcagcgcggcgtgtatggcttcgcgcgggtgaaagagaacgccggc
tacgtgctgtttgaatgctacgaagcgacggacgccgacaagctggcgcgcgagctgccg
ttcagcgagctgatttttgctcgtcagatggtggtggcaggcgagctgctgcgcgacctg
ccgcctgaagatcgcatctcgccgattgccggcatgctgaacggcgtggtggagaagggc
ggcgagctgcgggtggaggtgccggataccaacgaagcgaaagagctgctgaaattctgc
cgtaagtttaccgttccattgcgcgcggcgctgcgccagcaaaacagcctgctgaattat
gaaagcgcgaagcggccggtgattcacgttttctttatcgcttccggccactgctacgtg
ggctattcttatcctgataataactcgccgttttttatgggcattccgcgccttaaattc
ccggccgacgcgcccagccgctctacgctaaagctggaagaggcgtttcacgtctttatt
cccgccgacgagtgggatgaacgtctggcgagcggtatgtatgcggtcgatctgggtgcc
tgtcccggcggctggacgtatcagctggtgaaacgcagcatgatggtgcatgcggtagat
aacggcccgatggcgccgagcctgatggataccggacaggtgatgcaccaccgtgaggat
ggctttaaatatcgcccgacgcgcagcaatatcagctggctggtttgcgatatggtggaa
aaaccggtgcgcgtcgccaatctgatggcggaatggctgattaacggctggtgtcgcgaa
gcgattttcaacctcaagctgccgatgaaaaagcgctacgaagaggtttcgcagaacctg
acgatgattcaggaaaagctgcgtgaaaatggcattaacgcccagattcaggcgcgccag
ctctatcacgatcgcgaagaagtgacagtgcatattcgtcgcatctggggtgcggcgccg
ggccgccgcgacgagcgttaa

DBGET integrated database retrieval system