KEGG   Mixta calida: C2E16_16890Help
Entry
C2E16_16890       CDS       T05419                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
pcd  Mixta calida
Pathway
pcd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2E16_16890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcd03400]
    C2E16_16890
Enzymes [BR:pcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     C2E16_16890
DNA repair and recombination proteins [BR:pcd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2E16_16890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AUY26408
Position
complement(3538701..3542090)
Genome map
AA seq 1129 aa AA seqDB search
MFTVYHSNQLDILKSLAAYLIENEPLRDPFQSEVVLVQSPGMAQWLQMQLAQQFGIAANI
AFPLPATFIWDMFVRVLPGIPKESAFNKSSMSWKLMTLLPNLLREEAFRPLQHYLNDDDD
KRKLFQLASRVADLYDQYLVYRPEWLNSWQQGQTIDGLGEAQQWQAPLWARLVEYTRELG
QPEWHRANLYARFIQKLENSAERPAGLPDRVFICGISALPPVYLQALQALGKHIDIHLLF
TNPCRHYWGDIQDYAFLAKLQSRRRRHHQQQQEIALFRDPDEASSLFNDEGEQQLTNPLL
ASWGKLGRDNLYLLAQMEAREIDAFVEVPDDTLLRAMQHDLLELEDNAVIGLNAEELNSS
HKKRLLDPQDRSVVVHVCHSPQREVEVLQDQLLAMMEADPSLTPRDIIVMVADIDAYTPY
IQAVFGNAPTDRYLPFAISDRRASFAHPAIMAFINLLGLPESRFACEEVLALLEVPALAA
RFAIDEEGLRRLRMWVEESGIRWGLDDDNVRELELPPTGQHTWRFGITRMLLGYAMESEH
GHWDGILPYDESSGLIAELAGNLAELLMQLNHWRQVLARPRALTDWQPLCREMLQAFFAA
DVNTDAALMLIEEQWQQVMTWGLQARYDDAVPAALLRDELAARLDQQRISQRFLAGPVNF
CTLMPMRSVPFRVVCLLGMNDGVYPRTLPPLGFDLMAQQPQKGDRSRRDDDRFLFLEALL
SAQQRLYISYIGRSIQDNTERYPSVLVTELVDYIAQRFHLPGDEALDVDSSARRVLDHLH
CLHSRMPFDPQNFAPQSEYRSFAHEWLPAARGSGEPHPPFMQPLPPLPLNELSFEQLLRF
WRHPVRAFFTLRLGVSFALEQTELPDAEPFVLDALDRYQINAQLLNALIEEEDTQRLFHH
HRAAGVLPYGAFGELFWQTQQEEMAPLAEQVRELRDESRSVEIDLTIADVRLNGWLPQVQ
ESGLLRWRPGVLNFTDGLALWLEHLAWCAMGGQGQSRMLGRKESRWCFDAIDAEQARSWL
TRYVEGYRDGMCSPLLLLPKTGGAWLEASYDAKNDIMLMDEATQAKARAKLLTAWQGNYQ
LEGEGSDPYLQRLFRTLEATHLDAICSAAEQWLLPLLRFNRGDTQKNDE
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgtttacggtttatcactccaaccagctcgatatcctcaaatcgctggcggcgtatctg
attgaaaacgaaccgttacgcgatcctttccagtctgaagtggtgctggtgcaaagccct
ggcatggcgcagtggctgcaaatgcagctggcgcagcagttcggcatcgccgccaatatc
gcctttccgctgcccgccacctttatttgggatatgttcgtgcgcgtgctgcccggcatt
cccaaagaaagcgcctttaataaatccagcatgagttggaagctgatgacgctgctgccg
aacctgctgcgcgaagaggcgtttcgcccgttgcagcactatctcaacgacgacgacgat
aagcgcaagctgtttcagctcgcctcgcgcgtcgccgatctttatgaccagtatctggtc
taccgccctgaatggctcaacagctggcagcagggccaaaccatcgacggactgggcgaa
gcgcagcagtggcaggcgccgctctgggccaggctggtggaatatacgcgcgagctgggg
cagccggagtggcatcgcgccaatctctacgcccgctttattcaaaagctggaaaacagc
gccgagcgtccggcggggctgcccgatcgcgtctttatctgcggcatttcggcgctgccg
ccggtctacctgcaggcgctgcaggcgctgggcaagcatatcgacattcatctgctgttc
actaatccctgtcgccactactggggcgacattcaggactacgcttttctggcgaagctg
caaagtcgccgccgtcgccaccatcagcagcagcaggagatcgcgctgttccgcgacccg
gatgaggcttcttccctgtttaacgacgagggcgaacagcagctgaccaatccgctgctc
gcctcctggggcaagctgggacgcgacaatctctatctgctggcgcagatggaggcgcgc
gaaatcgacgcgtttgtcgaggtgccggacgacacgctgctgcgggcgatgcagcacgat
ctgctggagctggaggataacgcggtaatcggcctgaacgccgaagagctgaacagcagc
cataagaaacgcctgctcgatccgcaggatcgttccgtggtggtgcatgtctgccacagt
cctcagcgtgaagtggaggtgttgcaggatcagctgctggcgatgatggaggcggacccg
tcgctgacgccgcgcgatattatcgtgatggtggccgatatcgacgcctacacaccctat
attcaggcggtatttggcaatgcgcctacggatcgttatctgccgttcgccatttcagat
cgccgcgccagcttcgcccatccggcgatcatggcctttatcaacttactgggcctgccg
gaaagccgcttcgcctgcgaagaggtgctggcgctgctggaggtgccggcgctggcggca
cgcttcgccattgatgaagaagggttgcgccgcctgcggatgtgggtcgaggagtcgggc
atccgctgggggctggatgacgataatgtgcgcgagctggagctgccgccgaccggccag
cacacctggcgcttcggtattactcgcatgctgcttggctatgcgatggagagcgaacat
ggccactgggacggcatcctgccttacgatgaatccagcggtctgatcgccgagctggcg
ggcaacctggcggagctgctgatgcagcttaaccactggcgtcaggtactggcgcgaccg
cgcgcgctgaccgactggcagccgctgtgtcgggagatgttacaggcgtttttcgccgcc
gacgtaaataccgacgccgcgctgatgctgattgaagagcagtggcagcaggtgatgacc
tggggtttgcaggcgcgttacgacgacgcggtgccggcggcgttgttgcgcgatgagctg
gccgcccgcctggatcagcagcgcatcagccagcgttttctggcggggccggtcaacttc
tgcaccctgatgccgatgcgctcggtgccgttccgcgtggtctgcctgctgggtatgaac
gacggcgtttacccgcgtacgctgccgccgctgggcttcgatctgatggcgcagcagccg
caaaaaggggaccgcagccgccgcgacgatgaccgttttctgtttcttgaggcgttgctg
tcggcgcagcagcgtctttatatcagctatattggccgctcgattcaggacaatacggaa
cgatatccctcggtgctggtcactgaactggtggattacatcgcgcaacgttttcatctg
cccggcgacgaagcgttggacgtcgacagcagcgcccggcgcgtgttggatcatctgcac
tgtctgcacagccggatgccttttgatccgcagaacttcgcgccgcagtcggaatatcgc
agcttcgcccatgagtggctgcctgcggcgcgcggcagcggcgagccgcatccgccgttt
atgcagccgttgccgccgttgccgctcaacgaactgagctttgaacagctgctgcgcttc
tggcgtcatccggtgcgcgcgttttttacgctgcgcctcggcgtcagtttcgcgctggag
cagacggagctgccggacgccgaacctttcgtgctggacgcgcttgaccgttatcagatc
aacgcgcagctactgaacgcactgattgaggaagaagacacccagcggctgttccatcat
catcgcgcggcgggcgtactgccctacggcgccttcggcgagctgttctggcaaacgcag
caggaagagatggcgccgctggcggagcaggttcgggagctgcgcgacgagagccgcagc
gtagagatcgacctgacgatcgcggacgtcaggctcaacggctggctgccgcaggtgcag
gaaagcgggctgctgcgctggcggccaggcgtgctgaacttcaccgatggcctggcgctc
tggctggagcatctcgcctggtgcgccatgggcggtcaggggcagagccgcatgctggga
cgcaaagagagccgctggtgcttcgacgcgatcgacgcggagcaggcgcgaagctggcta
acccgttatgttgaaggctatcgtgacggcatgtgctcgccgctgctgctgctgccgaaa
accggcggcgcctggctggaggcgagctacgacgccaaaaacgatatcatgctgatggat
gaggcgacccaggcgaaagcgcgcgcgaagctgctcaccgcctggcaagggaactatcag
ctggagggagaagggagcgatccctatctgcagcggctgttccgcacgctggaggcgacg
catcttgacgctatctgctccgccgccgagcagtggctgctgccgctgctgcgctttaac
cgcggcgatacgcagaaaaacgacgaatag

DBGET integrated database retrieval system