KEGG   Pediococcus claussenii: PECL_1101Help
Entry
PECL_1101         CDS       T01713                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pce  Pediococcus claussenii
Pathway
pce00010  Glycolysis / Gluconeogenesis
pce00052  Galactose metabolism
pce00500  Starch and sucrose metabolism
pce00520  Amino sugar and nucleotide sugar metabolism
pce00521  Streptomycin biosynthesis
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01120  Microbial metabolism in diverse environments
pce01130  Biosynthesis of antibiotics
pce01200  Carbon metabolism
Module
pce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_1101 (glcK)
   00052 Galactose metabolism
    PECL_1101 (glcK)
   00500 Starch and sucrose metabolism
    PECL_1101 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    PECL_1101 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PECL_1101 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PECL_1101 (glcK)
Enzymes [BR:pce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PECL_1101 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEV95364
UniProt: G8PDM9
Position
complement(1096547..1097509)
Genome map
AA seq 320 aa AA seqDB search
MDSKLIGVDLGGTTIKFAILTLEGEVQQKWSVETNILDEGSHIVPDIIESINHHIDLYKM
DKSQFVGIGMGTPGTVDRDKGTVIGAFNLNWKTTQNVKDDIEAGTGIKFAVDNDANVAGL
GERWKGAGENGDDVSFVTLGTGIGGGLIAGGQLLHGKAGAAGEIGHVTVEPNGYLCTCGK
RGCLEQYASATGVVHVARDLAEEFSGESTLKQQADDGQDITSKLVFDLAKDGDPLALRVV
DRVSYYLGLALGNLGNTLNPESIVIGGGVSAAGEFLLDRVNDYFQQFAFSTVRTSTELKL
ARLGNDAGVIGAASLARTFA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaaattaattggcgtagatttaggtgggacaactattaagttcgctatttta
acgcttgagggtgaagttcaacaaaaatggagcgttgaaacaaacattctagatgaaggg
tcacacatcgtaccagatattattgaatcaattaatcatcatattgatttatataaaatg
gataagtctcagttcgttggaattgggatgggaactccagggacggtagatcgcgataaa
gggaccgttattggtgctttcaatttaaattggaaaacaacacaaaacgtgaaggacgat
attgaagcaggcactggaattaagtttgccgttgataatgatgctaatgtggctggtttg
ggtgaacgatggaaaggcgctggtgaaaacggagatgacgtttcattcgttacactcgga
actggtatcgggggcggtttgattgctggtggccaattattgcacggaaaagctggtgca
gctggagaaattggtcatgttaccgttgaacctaatggatatttgtgtacatgtggtaaa
cgtggatgcttagaacaatacgctagtgcaacgggggttgttcatgttgctcgtgatctt
gctgaagaattttctggtgagtccaccttgaagcaacaagctgatgatggtcaagatatt
acttctaaacttgtttttgatcttgctaaagatggtgatccgttagctttacgtgtagtt
gaccgagtttcttattaccttggattagcacttggtaacttgggtaatactttgaaccct
gaaagcattgttattggtggtggggtttctgccgctggtgagtttttattagatcgggtt
aatgactattttcaacaatttgcattttcaacagttcgtacttcaacagaattaaaattg
gcacgtcttggtaatgatgctggggttattggagctgcttcacttgcccgtacttttgct
taa

DBGET integrated database retrieval system