KEGG   Pediococcus claussenii: PECL_1409Help
Entry
PECL_1409         CDS       T01713                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pce  Pediococcus claussenii
Pathway
pce00860  Porphyrin and chlorophyll metabolism
pce01100  Metabolic pathways
Module
pce_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PECL_1409 (cobC)
Enzymes [BR:pce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     PECL_1409 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Ribosomal_L50 W_rich_C
Motif
Other DBs
NCBI-ProteinID: AEV95633
UniProt: G8PEM4
Position
complement(1361414..1362013)
Genome map
AA seq 199 aa AA seqDB search
MDIILIRHGQTDYNLQKKFYGSADVPLNQNGIEDAQKLKDIFQKNAIQFDRVYFSPLKRA
VETMETCVNKSAVRIKMSNLVEKSFGHWEGLDANQIESKYPVEWQKWINDPFKVTPRGAE
KFDSFVKRVQQSTDYLINDAQVHQAKTILIVTHLGVLRVIDQYWNDPQDVFWNIQYKSGK
YTIYQMTNRIPKLMIRNIG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggatattattttaattcgacacggtcagactgattataatttacaaaaaaaattttac
ggttcagcggatgtgccacttaatcaaaatggtattgaagatgcacaaaaattaaaagat
atttttcaaaaaaacgcgattcagtttgatagggtctactttagtccattaaaaagagcg
gttgagacaatggaaacctgtgtgaataaatcggctgtccgcattaaaatgtctaatttg
gttgaaaaaagttttggtcactgggagggtcttgatgccaatcaaattgagagtaagtat
ccagttgaatggcaaaaatggattaatgatccatttaaagtcaccccaagaggagctgaa
aaatttgattcttttgtcaaacgagttcagcagtccactgattacttaattaatgacgcg
caagtacatcaagctaagacgatcttgatagtgacacatctcggagttttacgagtcatt
gatcagtattggaatgatcctcaggatgttttttggaatattcaatacaagtcaggaaag
tacacgatttatcaaatgactaatcgaattcccaaattaatgataaggaatattggatga

DBGET integrated database retrieval system