KEGG   Pediococcus claussenii: PECL_1546Help
Entry
PECL_1546         CDS       T01713                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pce  Pediococcus claussenii
Pathway
pce00230  Purine metabolism
pce00240  Pyrimidine metabolism
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01130  Biosynthesis of antibiotics
Module
pce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pce_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PECL_1546 (ndk)
   00240 Pyrimidine metabolism
    PECL_1546 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pce04131]
    PECL_1546 (ndk)
Enzymes [BR:pce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PECL_1546 (ndk)
Membrane trafficking [BR:pce04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PECL_1546 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AEV95764
UniProt: G8PAH5
Position
complement(1494378..1494806)
Genome map
AA seq 142 aa AA seqDB search
MMTEERTLMLVKPDGVASGHVGDVITRIENRRFKITAIRTLTASPEELRVHYQQLVGKSF
YSGIEDFMTSGPIVAMIISGSDVVESIRKMTGPTDPAEAPAGTIRGDFARGWGDGPIQNV
VHSSDSIESAEREIKIWFPDEK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
ttgatgactgaagaacgtactttaatgttagtaaaacctgatggagtggcaagcgggcat
gttggtgatgtgattactaggattgaaaaccgccgttttaagattacagcaattcggact
ttaactgcatcacccgaagaattacgagttcattatcaacaattagtaggcaaatcattt
tattcaggtattgaggattttatgacttcaggaccaattgtagcaatgataatatcggga
tcggatgttgttgaaagcatccgaaaaatgacagggccaaccgatccagcagaggccccg
gctggaactatccgtggagattttgcccgtgggtggggagatgggccaatccaaaatgta
gtgcacagctcagacagtattgagagtgctgaacgcgaaattaaaatttggtttccagat
gaaaaataa

DBGET integrated database retrieval system