KEGG   Pediococcus claussenii: PECL_1606Help
Entry
PECL_1606         CDS       T01713                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pce  Pediococcus claussenii
Pathway
pce00071  Fatty acid degradation
pce00072  Synthesis and degradation of ketone bodies
pce00280  Valine, leucine and isoleucine degradation
pce00310  Lysine degradation
pce00362  Benzoate degradation
pce00620  Pyruvate metabolism
pce00630  Glyoxylate and dicarboxylate metabolism
pce00640  Propanoate metabolism
pce00650  Butanoate metabolism
pce00900  Terpenoid backbone biosynthesis
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01120  Microbial metabolism in diverse environments
pce01130  Biosynthesis of antibiotics
pce01200  Carbon metabolism
pce01212  Fatty acid metabolism
pce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PECL_1606 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    PECL_1606 (thlA)
   00640 Propanoate metabolism
    PECL_1606 (thlA)
   00650 Butanoate metabolism
    PECL_1606 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PECL_1606 (thlA)
   00072 Synthesis and degradation of ketone bodies
    PECL_1606 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PECL_1606 (thlA)
   00310 Lysine degradation
    PECL_1606 (thlA)
   00380 Tryptophan metabolism
    PECL_1606 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PECL_1606 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PECL_1606 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PECL_1606 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pce04147]
    PECL_1606 (thlA)
Enzymes [BR:pce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PECL_1606 (thlA)
Exosome [BR:pce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PECL_1606 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF3147
Motif
Other DBs
NCBI-ProteinID: AEV95824
UniProt: G8PAV6
Position
1544745..1545908
Genome map
AA seq 387 aa AA seqDB search
MKNVYIVSAGRTPIGKMGGVLADLSAVNLGTLMIAELLKRAHVSADDVDEVLLGNVLQAG
NGQNPARQAALNAGLPNSVVALTLNAVCGSGLESINQAAKLIAMGDIKVAIAGGMESMSN
APYLLRKARFGYRLGNDELVDSMMNDALTDAFNNYPMGITAENVATLKKVSKHEMDIFAI
NSQNKAVLAQTNGSFSEEIIPVKISNKTINLDEAPRPHLDINKLDNMKPAFKPDGVVTAA
NSAGINDGAAGVLLMDEDTMHHLGLTPIAKWNYGTMAGIDPTIMGLGPINSTQKLMEHES
ISINDIDLFEVNEAFAAQAIPVISTLKIPTNKVNIHGGSIALGHPVGASGARILVSLIYA
MKQKNAKTGVATLCIGGGMGCSTLISR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtttacattgttagtgctggtcgtaccccgattggaaagatggggggagtt
ttagcagacctttctgccgttaacctaggaactctgatgattgcagagctattaaagcga
gcgcacgtatctgctgacgacgttgacgaagtattgctgggaaatgtccttcaggctggt
aacggacaaaacccagcaaggcaagccgccttaaacgcagggttacctaacagtgttgtt
gctcttaccctaaatgccgtttgtggatcaggactagaaagtatcaatcaagctgccaaa
ttgatcgcaatgggtgacattaaagttgcaattgctggtggaatggagagcatgtcaaat
gcaccttatttgttacgcaaagcacgttttggatatcgtctgggaaatgacgaattggtt
gattcaatgatgaacgatgcgttaacagatgcttttaataactatcccatgggaattaca
gccgaaaatgttgccacattaaaaaaagtatctaagcatgagatggatattttcgcaatt
aatagtcaaaacaaagcagttctggctcaaactaatggaagcttttccgaagaaattatt
cccgttaaaatttccaataaaacaattaatttagacgaggctccgcgtccacatttggat
attaataaacttgataatatgaaaccagctttcaaacctgatggagtcgtaactgctgct
aactccgctggaatcaatgacggggctgcaggcgtcttactaatggatgaagatacaatg
catcacctaggtcttactccaattgctaaatggaattatggtaccatggcaggaattgat
ccaactataatgggacttggcccaattaactccacccaaaaactaatggaacacgagagc
ataagcattaatgatattgacctttttgaggtaaatgaggcttttgctgcccaagctatc
cccgtaattagcaccctcaagattccaaccaacaaagtcaatattcatggtggatccatt
gccttaggccatcccgttggggcatctggcgctcgcatactggtttctctaatttacgca
atgaaacaaaaaaacgccaaaactggcgttgctacactctgtattggtggtggaatgggg
tgttctaccttaatatctagatga

DBGET integrated database retrieval system