KEGG   Pediococcus claussenii: PECL_559Help
Entry
PECL_559          CDS       T01713                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
pce  Pediococcus claussenii
Pathway
pce00030  Pentose phosphate pathway
pce00480  Glutathione metabolism
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01120  Microbial metabolism in diverse environments
pce01130  Biosynthesis of antibiotics
pce01200  Carbon metabolism
Module
pce_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PECL_559 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PECL_559 (gnd)
Enzymes [BR:pce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     PECL_559 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     PECL_559 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored 2-Hacid_dh_C DapB_N PDH UDPG_MGDP_dh_N IlvN TrkA_N GFO_IDH_MocA 3HCDH_N NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: AEV94858
UniProt: G8PC39
Position
complement(565922..566818)
Genome map
AA seq 298 aa AA seqDB search
MKVGVIGLGKMGMNLALNMKENKHQPIGFDLDSKNLKEAQNLDIMTASNMDNLLSQLDEQ
KIVWAMVPSGKPTDSVLTELSEKLSKNDIIIDGGNSFYKDSIKHNELFTEKGIHFFDVGT
SGGMSGARNDGNFMIGGDAEAFKIIEPLFKAIAAKNGYLYTGKAGSGHYLKMVHNGVEYG
MMASIGEGFDVLEHSPFEYDNEAVARVWNNGSVIRSWLMELAEDAFKEDGNLDNIKGTMH
SSGEGRWTLDEALNQEIATPVIAMALLMRYRSLENDTFSGKVVSALRNGFGGHATDKE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggagtaattggtttaggaaaaatgggtatgaatctggctttaaacatgaaa
gaaaataaacatcagcctattggatttgatttggattctaaaaatctaaaagaggcgcaa
aatctagacattatgacagcctcaaacatggacaaccttttatcacaacttgatgagcaa
aagattgtttgggcaatggtaccatcaggcaaaccaactgatagcgttttaaccgaatta
tctgaaaaactttccaaaaacgatattataattgatggcggaaattccttttacaaagat
agtatcaaacataatgaactatttactgaaaaaggaattcatttctttgatgtcggtact
tcaggtggaatgagtggcgcacgtaacgacggaaactttatgataggtggagatgcagaa
gcatttaagatcatcgaacctcttttcaaggcaattgctgccaaaaatggatacttatac
acaggaaaagccggtagtggtcattatctaaaaatggtacataacggtgtggaatacggc
atgatggcctccattggagaagggttcgatgttttggaacatagtccctttgaatacgat
aacgaagctgttgctcgcgtgtggaataacggctctgttatccgcagctggctaatggag
cttgcagaagatgcttttaaagaagacggaaaccttgataacattaagggaaccatgcat
tcttctggtgaaggtcgttggaccttggatgaggctcttaatcaggagattgccactcct
gtaattgccatggcactcttaatgcgttaccgatcacttgaaaacgatacattttctgga
aaagttgtttcggctctccggaatggttttggcggacatgcaactgataaggagtaa

DBGET integrated database retrieval system