KEGG   Pediococcus claussenii: PECL_654Help
Entry
PECL_654          CDS       T01713                                 

Definition
(GenBank) mur ligase middle domain protein
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pce  Pediococcus claussenii
Pathway
pce00300  Lysine biosynthesis
pce00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PECL_654
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PECL_654
Enzymes [BR:pce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     PECL_654
Peptidoglycan biosynthesis and degradation proteins [BR:pce01011]
 Precursor biosynthesis
  Amino acid ligase
   PECL_654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M OrfB_Zn_ribbon Zn_Tnp_IS1595 TF_Zn_Ribbon Auto_anti-p27 Zn_ribbon_17 A2L_zn_ribbon zf-Mss51 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: AEV94946
UniProt: G8PCG1
Position
complement(668955..670304)
Genome map
AA seq 449 aa AA seqDB search
MSLKSSFAKFAGKSSYWFLHTFRSGGSSFPGKITTKIDPDILKSLGKDYDVIVITGTNGK
TLTTALTVKVLRQKYEHVLTNPTGSNMEQGIVTTFLTDHKTKNGKNLAILEVDEANVIKV
TKYIKPLAFVFTNIFRDQMDRYGEIYTTYQKILDGVALAPEATIIANGDMPIFNSKKLPN
PIIYYGFNDRPDGELRAHYNTDGVLCPVCQHIIHYKFITYSNQGKYYCPNCGWHRPELRY
QVTALSKLTPNNSKFFIDGSNFNIHIGGLYNIYNALAAYSVGKFMGVSTSAIQKALNDPD
ERVFGRQEQINVDGKEVTIVLVKNPVGLNQVIDMVGTETEPFSFVGLLNANYADGLDTSW
IWDGNFEKLTTMNIKQYVTGGERYKDITFRLKVAGVQDNQLETYNNLKDAVANIKNLPTK
RVYVFATYTAMLQLRKQLATDGYIKEGIA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaagagttcatttgctaaatttgctggaaaatcttcttactggtttttacac
acttttcgttctggtggaagttcttttcccggaaaaattaccacaaaaatcgatcctgat
attttaaaaagtttgggtaaagactatgatgtcattgtcattactggtacaaacggaaaa
actctaacaaccgctctcactgtcaaagttttacgccaaaagtacgaacacgtattaaca
aatccaactggttcaaatatggaacaaggtattgtcacaacatttttaactgatcacaaa
accaaaaatggtaaaaatttggcaattcttgaggttgatgaagcaaatgtcattaaagtc
actaaatatatcaaaccactcgcgtttgtttttaccaatatttttcgggaccaaatggat
cgctatggtgaaatttatacaacataccaaaagatattggacggcgtggcattagctccg
gaagctactataattgccaacggtgatatgccaatcttcaattccaaaaaattacctaat
ccaattatttattatggctttaatgatcgtccagatggtgaactacgtgcccattataat
acagacggtgtgctctgtccggtctgccaacatatcatccattacaagtttattacctat
agtaatcagggaaaatattactgtccaaactgtggatggcatcgcccagagttgcgttac
caagtcactgcgctctctaagctaacacctaataattcaaagttctttattgatggtagc
aactttaacattcatattggtgggctttataatatctacaatgcgctggcagcatattcc
gtgggtaagtttatgggagtttcaacttctgcaattcaaaaagccttaaatgatcctgat
gaacgtgtctttggtcgtcaagaacagattaatgttgatggtaaagaagtcacaattgta
ttagttaagaacccagttggactaaaccaagtcattgatatggttggtaccgaaactgaa
ccattttcgtttgtcggtcttttaaatgctaactacgccgatggtcttgacacgagttgg
atttgggacggtaactttgaaaaattaacaacgatgaatattaagcaatatgtaaccggc
ggagagcgctataaagatattactttccgcttaaaagttgctggggttcaagataaccag
cttgaaacctacaataatttaaaagatgcagttgcaaatattaagaatttacccacaaaa
cgcgtttatgttttcgcaacttacacagctatgttacaattgcgcaaacaattagcaaca
gatggttacatcaaggagggaatcgcataa

DBGET integrated database retrieval system