KEGG   Pediococcus claussenii: PECL_893Help
Entry
PECL_893          CDS       T01713                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pce  Pediococcus claussenii
Pathway
pce00010  Glycolysis / Gluconeogenesis
pce00030  Pentose phosphate pathway
pce00051  Fructose and mannose metabolism
pce00052  Galactose metabolism
pce00680  Methane metabolism
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01120  Microbial metabolism in diverse environments
pce01130  Biosynthesis of antibiotics
pce01200  Carbon metabolism
pce01230  Biosynthesis of amino acids
pce03018  RNA degradation
Module
pce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pce_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_893 (pfkA)
   00030 Pentose phosphate pathway
    PECL_893 (pfkA)
   00051 Fructose and mannose metabolism
    PECL_893 (pfkA)
   00052 Galactose metabolism
    PECL_893 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PECL_893 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PECL_893 (pfkA)
Enzymes [BR:pce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PECL_893 (pfkA)
Protein phosphatases and associated proteins [BR:pce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PECL_893 (pfkA)
Messenger RNA biogenesis [BR:pce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PECL_893 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase ExbD
Motif
Other DBs
NCBI-ProteinID: AEV95162
UniProt: G8PD27
Position
893876..894847
Genome map
AA seq 323 aa AA seqDB search
MKRIGILTSGGDAPAMNAAIRAVARKAISSGLEAYGINYGFAGLVAGDIHKFEATDLDNS
IDTGGTLLYSARYPEFAQEEGQLKGIEQLKKFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPYTDFTIGFDTALNTAVDAIDKIRDTAKSHQRVFAIQVMGRFAADIALWA
GVASGADAVIAPGFDYSVEKIANKLKKNRANGKDYGLIVIAEGDANSDAAPEFIDQLKQY
GDFDARATVIGHVQRGGVPSARDRVLASKMGAYAVELLLEGRGGLAVGILDNKVQAHDIT
DLFDAKHQADLSLHQLAEDLSFK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtattttaactagcggtggcgatgctccagctatgaatgctgcaatt
cgtgccgttgctcgtaaggccatcagttctggtcttgaggcttatggtattaactatggt
ttcgctggcttagttgctggtgacatccataaatttgaagcaacagatcttgataattca
attgatacgggtggtacattgctttattctgcccgttaccctgagtttgcgcaagaagag
ggtcaattgaaaggaattgaacaacttaagaaattcggaattgatgctcttgttgttatt
ggtggcgatggttcatatcacggggcacttcgcttaaccgaacatggatataacacaatt
gggttacccggtacaattgataacgatattccatatacagattttacaattggttttgat
actgctcttaatacggctgtagatgcaattgataagattcgtgacacggccaaaagtcat
cagcgtgtttttgccattcaggtgatggggcgttttgctgctgatattgctctttgggca
ggtgttgcttctggtgctgatgcagttattgcaccaggatttgattatagcgttgaaaaa
attgctaacaagcttaagaaaaatcgtgcaaacggtaaagattatggtttgattgtaatt
gctgaaggcgatgctaattcggatgctgcacctgaatttattgatcaactcaagcaatat
ggtgattttgatgcccgagctacagttattggacacgtacaacgtggtggagttccatca
gctcgtgaccgtgtgctagctagcaagatgggggcatatgcagttgagcttctacttgaa
ggtagaggtggccttgctgttgggatccttgataacaaggttcaagctcatgatattaca
gatctttttgatgcaaaacatcaagcagatctttcattacatcaattagctgaagatctt
tcatttaaataa

DBGET integrated database retrieval system