KEGG   Polistes canadensis: 106783586Help
Entry
106783586         CDS       T05611                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pcf  Polistes canadensis
Pathway
pcf00010  Glycolysis / Gluconeogenesis
pcf00562  Inositol phosphate metabolism
pcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106783586
   00562 Inositol phosphate metabolism
    106783586
Enzymes [BR:pcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106783586
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106783586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106783586
NCBI-ProteinID: XP_014597741
Position
Unknown
AA seq 446 aa AA seqDB search
MHKMIFNLRIVFIFLTTNIFCFAYDCFLQDDNYKCRLGTKTPYRFIASHNDKPIEYPGCV
PKKIWLILRHGTRYPGKKYVSRMTKDLLKLKEIIINNYKMNETNLSHDIIVNLANWKMRF
TKNDTMNLAEEGENEMIDLGERYQSRFPTIMPETYDNKTYKFKYTATQRTEESAKYFAAG
LFGWFNSQNVWYPKAEHKDPVLRFYKLCTRWRSEVDKNTSAIIEKEKFLRSEVFMNTLKS
ISKRIGHPVNHEIVHLIYTMCGFETAWYKDTDSPWCKLLSLDEFKVVEYSEDLEYYWIDG
YGYKITYEQACVVLKDIFKFFSEDDGILASIYFTHSGTILKLLSRLRAVQNTVPLTHDSF
WLHVDNRAWRTTYIDAFASNIAFVLYNCESQGPSILFMHQERIKYLPNCPNNMPCPLSKM
KDLYLNREEECLFDAICNLPKNDESS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaatgatatttaatttacgtatagtttttatatttttaacaactaatattttt
tgctttgcatatgattgtttcttacaagatgataattataagtgtaggttaggaacaaaa
acaccttatagatttatagcttctcacaatgataaacctatcgaatacccaggatgtgta
ccaaaaaagatttggttgatcttaagacacggtacacggtatcctggaaagaaatatgta
tctcgcatgacaaaggatttactaaaattaaaggaaattataataaataattataaaatg
aatgaaactaatttatctcatgatattatagttaacttagctaattggaaaatgagattc
acaaaaaacgatacgatgaatcttgcagaggaaggagaaaatgaaatgattgatcttgga
gaaagatatcaatctagatttcctactattatgccagaaacatatgataataaaacttat
aagttcaaatatactgcgacacaaagaactgaagaaagtgctaaatactttgctgctggt
ttatttggctggttcaacagtcagaatgtttggtatcctaaagcagaacataaagaccct
gtcttaaggttctataaactttgtactcgctggcgtagtgaagttgataaaaatacatct
gcaatcattgagaaagaaaaattcttgagaagtgaagtgttcatgaatacattgaaaagt
atttcaaaaagaattggccatccagttaatcatgaaattgtacatttgatttacaccatg
tgtggctttgagactgcatggtataaggatacagattctccttggtgcaaattattgtct
ttggatgagttcaaggttgtcgaatactcagaggatttagaatattattggatcgatgga
tatggatacaagatcacttatgagcaagcatgtgtagttttgaaagatatctttaaattt
ttttcagaagacgatgggatattagcatcaatttattttacacattctggaactattctt
aaattattatcacgattaagagcagtacaaaatacagttccgttaacgcatgattcattt
tggttacatgtagataacagagcttggagaactacgtacatcgatgcttttgcaagtaat
atagcttttgttttatataattgcgaatcacaaggacccagcattctttttatgcatcaa
gaacgcattaaatatttaccaaattgtcctaacaatatgccatgtccattatcaaagatg
aaagatttatatttaaatcgtgaagaagaatgtttatttgatgcaatatgtaatttacct
aaaaacgatgaatcatcatag

DBGET integrated database retrieval system