KEGG   Polistes canadensis: 106783924Help
Entry
106783924         CDS       T05611                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase subunit 9
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
pcf  Polistes canadensis
Pathway
pcf00190  Oxidative phosphorylation
pcf01100  Metabolic pathways
Module
pcf_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106783924
Enzymes [BR:pcf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     106783924
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     106783924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 106783924
NCBI-ProteinID: XP_014598426
Position
Unknown
AA seq 266 aa AA seqDB search
MTSLLRNCWKLSQNLSSNVPKRYVQPFSLIRYNSTEVTEATEKAETRPTVRKPNPYVDVD
RLKEFGCYVSECLPKYIQKIQIVNKDELELLITPYGIFPTVAFLRCHHNAQFNNIVDITA
LDVPNRQYRFEVVYHFLSIVYNSRIRVKTYTDELSPLDSITEEFKGAEWYEREIWDMFGV
YFNRHPDLRRILTDYGFEGHPLRKDFPLSGYMEVRYDDEKKRVVAEPLELTQEFRKFDLS
APWEQFPNFRDTAPAIEDVVPEQTKK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgttgctaagaaattgttggaaattatcgcaaaacttgtcttcgaatgttcct
aaacgttatgtgcaacctttttcattgatacgatataatagtacagaagtaacagaagca
acagaaaaagcagaaactcgacctactgtacgcaaacctaatccttatgttgatgttgac
cgtttaaaagaatttgggtgctatgtttctgaatgcttaccaaagtacatacaaaagatt
caaatagttaataaggatgaacttgaactcttgattacaccttatggaatttttccaaca
gtagcatttttaagatgtcatcataatgcacaatttaataatatagttgatatcaccgca
ttggatgtacctaatagacaatacagatttgaagttgtctatcactttctatcaattgta
tataactctcgtattagagtaaaaacatacacggatgaattatccccacttgattcgata
accgaagaattcaaaggcgctgaatggtacgagcgtgaaatatgggatatgtttggtgtt
tatttcaatcgtcatcctgatctccgtagaattctaacagattatggttttgaaggacat
ccactcagaaaagattttccattgagtggatacatggaggttcggtacgacgatgagaaa
aagagggtagtagcagaaccattggaattaacgcaagaatttcgaaagtttgatttatcc
gcaccttgggaacaatttccaaactttagagacacagcaccagctattgaagatgtagta
ccagaacaaacaaaaaaataa

DBGET integrated database retrieval system