KEGG   Polistes canadensis: 106785027Help
Entry
106785027         CDS       T05611                                 

Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
pcf  Polistes canadensis
Pathway
pcf04136  Autophagy - other
pcf04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106785027
   04136 Autophagy - other
    106785027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcf04131]
    106785027
   03029 Mitochondrial biogenesis [BR:pcf03029]
    106785027
Membrane trafficking [BR:pcf04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106785027
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106785027
Mitochondrial biogenesis [BR:pcf03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106785027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 Cytochrom_D1 Nup160 Ge1_WD40 ecTbetaR2 Cluap1
Motif
Other DBs
NCBI-GeneID: 106785027
NCBI-ProteinID: XP_014600610
Position
Unknown
AA seq 568 aa AA seqDB search
MATHELESSYMSRNDNNWRRNIISQLRERNRIETFCFSDLITLHNRLFENVNTLRCQNMQ
LTISNENLRRESCNSPGPSASSVNEARLKQTEELTALHKKNGEHMQQIVDLNKKMQEMIK
ELHAKEASLAECKETNSILRSDIAKYLAREREYESINQMLKDEHQALQLAFASLEDKLRK
SQEENRQLVERLIKYKARDAEKMNEENDNFLNESFTSPTAFLMNTISKFGKRQAKMQKEL
EDAARDTRPVSPDRSSLKEGVAGLPTTVPTKVSVSFNAHEGEVYAVKWSPVDRILATGGA
DRKVKLWSIIKGTSECKGVLVGSNAGVMSVDFDSTGTLILGASNDFASRVWTLNDLRVKH
TLTGHCGKVMAAKFLGEPSKVVSGSHDRTLKIWDLRNKACTETKFTGSSCNDLVTSDGAG
STIISGHFDQRIRFWDTRAESSSNDIILEGKVTSLDLSRDTNYLLSCVRDDTVKLIDLRM
KKIIGSFSADGFKVGFDWTRAAFSHDGQYIAAGSSDGSVFVWSVATHMVENVLKNHAATV
TAVSWHPHGTFLASVDRSKTVTIWGDYV
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcacgagttggaatcgtcatatatgtccagaaatgacaataattggaggaga
aacattatctcacagcttcgcgaaaggaacaggattgaaacattttgtttttctgatctc
atcactttacataatagattatttgaaaacgtaaatacactacgttgtcaaaatatgcag
ttgacaatatcgaatgaaaatttaagacgtgagagttgcaatagtccaggaccaagtgcc
agttcagttaacgaagcacgcctgaaacaaactgaagaattaaccgcattacacaagaaa
aatggagaacatatgcaacaaattgtagatcttaataagaaaatgcaagaaatgataaaa
gaactacacgctaaagaagcaagtcttgcggaatgtaaggaaactaacagcatattacgc
tcagatatagcaaaatatctagctagagaaagagaatatgagagtataaatcaaatgctt
aaggatgaacatcaagctttgcaacttgcttttgcatctttggaagataaacttagaaaa
tcacaagaagaaaatcgtcaattggtagaacggttgattaaatacaaagcaagagatgca
gagaaaatgaacgaagaaaatgataattttttaaatgagagttttaccagtccaacagcc
tttttgatgaataccatatctaaatttggaaaacgacaagcaaaaatgcaaaaagagtta
gaagatgctgctcgtgatacacgacctgttagtcctgatagatcgagtttaaaagaaggt
gttgctggtcttcctactacagtaccaacaaaagtgtccgtctcatttaatgctcacgag
ggagaagtgtacgccgtaaaatggtctccagtcgacagaatcctggccaccggtggagcg
gacaggaaggtgaaactgtggagtataattaaaggcacgtccgaatgtaagggagtgctc
gtcggtagcaacgccggtgtaatgtcggttgactttgattcgacgggtaccctcatcctt
ggagcttccaacgacttcgccagcagggtatggaccctcaatgatcttcgggttaagcac
acgcttacgggccattgcggtaaggtgatggcggctaagtttcttggcgagccctcaaaa
gtagtttcgggcagtcacgatcgcactctcaaaatctgggatttacgtaacaaggcgtgt
acggaaactaaatttactggctcgagttgcaatgatcttgtgacgtcggacggtgccggt
tcaacgataatcagtggtcatttcgatcaaaggataagattttgggacaccagagcggaa
tcgtcatcaaacgacattattctcgaaggaaaggttacgtcattggatttatctcgcgat
acgaattatcttcttagctgcgtacgagatgacaccgttaagctgatagatttacgaatg
aagaaaattattggatcgtttagtgctgacggcttcaaagttggtttcgattggacacgg
gcagctttcagtcacgatggtcaatacatcgctgctggttcttccgacggatccgttttt
gtttggtctgtagcgacgcatatggttgaaaatgtgctaaaaaatcacgcggcaactgtg
acggctgtctcatggcatccacatggaactttcctagcatcggtcgaccgttcgaagacc
gttacaatttggggcgactacgtttga

DBGET integrated database retrieval system