KEGG   Polistes canadensis: 106785976Help
Entry
106785976         CDS       T05611                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pcf  Polistes canadensis
Pathway
pcf00030  Pentose phosphate pathway
pcf00480  Glutathione metabolism
pcf01100  Metabolic pathways
pcf01200  Carbon metabolism
Module
pcf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pcf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106785976
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106785976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcf04147]
    106785976
Enzymes [BR:pcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     106785976
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     106785976
Exosome [BR:pcf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   106785976
  Exosomal proteins of colorectal cancer cells
   106785976
  Exosomal proteins of bladder cancer cells
   106785976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 106785976
NCBI-ProteinID: XP_014602378
Position
Unknown
AA seq 521 aa AA seqDB search
MAKIKRRTSTEESLQFIRQSLKSDEMDHLEGTHFDRLLPHVFVTLGASGDLAKKKIYPTL
WWLFRDNLLPKITTFFGYARSNITVKQLREKCHPYMKLKPEEEVKYEEFWKLNYYISGNY
DSEEHFRILNNELQKHEKGSMANRLFYLALPPNVFESVTVHIKRVCMGQKGWTRIIIEKP
FGRDAISSQLLSDHLASLFDEEQIYRIDHYLGKEMVQNLMTLRFANRIFNPSWNRDNIAS
VQITFKESFGTEGRGGYFNEFGIIRDVMENHLLQILSLVAMEKPASCHPNDIRDEKVKVL
RCIKPIELNNVVLGQYVGNPDSNNPEAQLGYLDDPTVPPGSTTPTYALAVLKINNERWDG
VPFILRCGKALNERKAEVRVQYHDVPGDIFDGKTKRNELVIRVQPGEALYIKMMTKSPGI
TFDMEETELDLTYGNRYKHLKLPDAYERLILDVFCGSQMHFVRSDELFEAWRIFTPLLHQ
IEQEKIPPIPYKHGSRGPKEADDKAKENNFAYYGSYKWISS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaattaaaagaagaacatccacggaggagagtctgcagttcatccgacaatct
ttaaagtcggatgaaatggatcacctggaaggtacacatttcgacagactcttaccacac
gtgtttgttacactcggagcatctggtgatttagctaagaagaaaatttatccgactctc
tggtggcttttccgagacaatcttttaccaaaaataacgacatttttcggatacgctaga
agcaacataactgttaaacaattgcgagaaaagtgtcatccttacatgaaacttaaaccg
gaagaggaagttaaatacgaagaattttggaaattaaattattatattagcggtaattac
gattcggaagaacattttagaatcttgaacaatgagttgcaaaaacatgagaaaggttcg
atggccaataggcttttttatttggctttaccaccgaacgtttttgaatcggtcactgta
catattaaaagagtttgcatgggacaaaaaggttggacaagaattataatagaaaaacca
ttcggccgagatgctatttcatcgcaacttctttccgatcatcttgcgtcacttttcgat
gaagaacaaatctataggatagatcattatcttggaaaagaaatggttcagaatttaatg
acattaagatttgcaaacaggatattcaatccaagttggaacagggataacatagcttcc
gtacaaataacttttaaggaatcttttggtactgaaggaagaggtggatattttaatgag
tttggaattatcagggatgttatggaaaatcatttgctacagatattatcgctcgttgcg
atggaaaaacctgcctcgtgtcatccaaatgatatcagagatgagaaagttaaagtctta
agatgtataaagccaatagaattaaacaacgtagttttaggacaatatgtgggtaatcca
gattccaacaaccctgaggctcaattaggatatttagatgatcctactgtacctccaggt
tcaaccactccaacttatgcgctagcggtactgaaaattaataatgaacgatgggatggt
gttccttttattcttcgttgtggaaaagctctgaacgagcgtaaggctgaagttagagtt
caatatcacgatgtacctggtgatatattcgatggtaaaacaaaaaggaacgaattagtt
ataagagtacaacctggtgaagcgttgtacataaaaatgatgactaaatcacctggtatc
acttttgatatggaagaaacagaattagatctcacgtatggcaatagatacaagcatctg
aaattacctgacgcctacgagagattaattttggacgttttttgtggatcgcaaatgcat
ttcgttcgtagcgacgaacttttcgaagcgtggagaatttttacacctctattacatcaa
atcgaacaggaaaaaataccaccgattccttacaaacatggctctcgaggaccaaaagaa
gccgatgataaagcaaaggaaaataattttgcttattatggttcctacaaatggatatct
tcgtaa

DBGET integrated database retrieval system