KEGG   Polistes canadensis: 106786437Help
Entry
106786437         CDS       T05611                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pcf  Polistes canadensis
Pathway
pcf00730  Thiamine metabolism
pcf00790  Folate biosynthesis
pcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    106786437
   00790 Folate biosynthesis
    106786437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcf04147]
    106786437
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pcf00537]
    106786437
Enzymes [BR:pcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     106786437
Exosome [BR:pcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106786437
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pcf00537]
 Enzymes
  106786437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Phosphodiest Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 106786437
NCBI-ProteinID: XP_014603331
Position
Unknown
AA seq 525 aa AA seqDB search
MQVYLQFIVLLLSSIITATIIEDSQYWHRIAQNELEKSLLYRWNTGKAKNVIIFVGDGMS
PDTITASRIYRAGETSNLAWEKFPHIGLLKTYNTNKQVPDSASTATALFGGVKTNYEVVG
VDVNVKLGDCEASLNTSYHVESIIALAQASGKATGFVTTTRVTHATPAPLYAHCPNRRWE
CEAKMPKNMTACKDIARQLVENKPGRDIKVIMGGGRQTLRSNVKSGKYDPIDTWACYSTD
GRDLIRDWAKDKQERKIAFKVVENNEQLSMVDTEKVEYLFGIFANGHIKMDWEREKGPEG
QPSLEEMTVTALKVLNKSKNGYVLVVEGGLIDFAHHRGHAAQALLETVRFSDAINATINM
IDTKETLVIVTSDHGHSMSFNGYSDRGTSILGIAQKSRHDKIPYTTLTYSTGGPNNAAYT
INSTKHLTRIDPSTYDTTAFNYSQQAAIVSDEAYHGGGDVAVYAIGPSAHLFHSVHEQNY
VAHVIRYAADLKNYANGSEQINLHYTVLVISILLGITTMLTLCKG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgtatctacagttcattgtacttctactttccagtattataaccgctacgatt
atagaagacagtcaatattggcatagaatagcacaaaacgaattagaaaaatctctttta
tatcgttggaatacaggtaaagcgaaaaacgtgataatatttgtcggagatggcatgagt
cccgataccataacagccagtagaatttatcgagctggtgaaacgagtaatctcgcttgg
gaaaaatttccacacattggtttactcaagacgtacaatacgaataaacaagtaccagat
tcggcgtccacagctaccgcattatttggcggagttaaaaccaattacgaagttgtaggt
gtcgacgttaatgtcaaattgggagattgcgaggctagcttgaatacaagttatcatgtt
gaatccattattgcattggcacaagcttcgggcaaagctacaggatttgtaacaacgaca
agagtaacccatgcaacaccagcacctctgtatgcacattgtccaaatcgaagatgggaa
tgcgaggcaaagatgcctaaaaatatgaccgcttgcaaggatattgcaagacaactcgtt
gagaacaagcctggtagagacatcaaggtgataatgggtggcggtaggcaaaccttgaga
tctaacgttaagtctggtaaatacgatccgattgacacgtgggcttgttatagtacagat
ggtcgggatttaataagagattgggcaaaggataaacaagaaagaaagattgccttcaaa
gtagtcgagaataatgaacaattgtcaatggttgataccgagaaggttgaatatttgttt
ggtatatttgccaatggtcatattaaaatggattgggaaagagaaaaaggtccagaaggg
caaccaagtttggaagaaatgaccgtgactgcgttgaaggttctcaataaatcaaaaaat
ggttacgtattggtggtcgaaggaggattgattgatttcgctcatcatcgtggccatgct
gcccaagctttgctagaaaccgtaagattttctgacgcaattaatgctactattaacatg
atcgacacgaaagaaactttagttattgtaactagcgatcatggtcattctatgagcttc
aatggttatagcgatcgtggtacatcgattctaggtattgctcaaaaatctagacacgat
aaaataccctacacgactttaacatacagtaccggaggtccaaataatgcagcttatacg
ataaacagtactaaacatttaacaagaatcgatccgtctacttatgacaccacagcgttc
aattatagtcaacaagctgctatcgtatccgacgaagcttatcatggaggaggagacgtt
gcagtttatgctattggtccatccgcgcatctattccatagcgttcatgagcaaaattac
gttgcccacgtaataaggtatgctgctgatctaaaaaattatgcgaacggtagcgaacaa
attaatcttcattacactgtactcgtaatatcaatcctgttaggtattacaactatgtta
actttgtgcaaaggataa

DBGET integrated database retrieval system