KEGG   Polistes canadensis: 106787769Help
Entry
106787769         CDS       T05611                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pcf  Polistes canadensis
Pathway
pcf00350  Tyrosine metabolism
pcf00360  Phenylalanine metabolism
pcf00380  Tryptophan metabolism
pcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106787769
   00360 Phenylalanine metabolism
    106787769
   00380 Tryptophan metabolism
    106787769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcf04147]
    106787769
Enzymes [BR:pcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106787769
    4.1.1.105  L-tryptophan decarboxylase
     106787769
Exosome [BR:pcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106787769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 106787769
NCBI-ProteinID: XP_014605905
Position
Unknown
AA seq 508 aa AA seqDB search
MDDKDFLDFGKTTIDFIANYIKTLKDRPVLPNVEPGYLSQMIPGEAPVKAETWQEVFKDI
ERVILPGMTHWHSPHFYAYFPAAPSYASIVGELLCAGLGGVGFSWICSPVFTELEVITLN
WLGKMLNLPSEFLNCSNGSGGGVIQGSASETTLICLITAKDRITRRMKSIHPDWDVGMIR
SKLVAYSSDQANSSVEKAGLLATVQMKLLPSDENGSLRGDTLLKAIKNDLENGLIPCFVC
ATLGTTGTCALDNLDELGPICNQYDLWLHVDAAYVGAAFVCPEYRHLMTGVHYADSFNVN
CHKWMLVNFDCSAMWVKDSKYLIEAMNVDRIYLAHDKQGVTPEFRHWQIQLGRRFRSLKL
WFVLRLHGIEGMQQHIRNTVSIANKFAKYVESDKRFELVTNSMGLISFRLKGEDDWTQEL
VKRLTERKRIFVIIATLNDKYIIRFCICSPLCQEKDIKFAWNEISEQATEILQAKHHPVK
ENLNQPSVKSYDDITLRIENLSHESKGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaggattttcttgatttcggcaaaactacgattgattttattgcgaattat
attaaaacattgaaagatagacctgtacttcctaacgttgaacctggttatctcagtcaa
atgataccaggagaagcgcctgtaaaagctgagacttggcaagaggttttcaaagatatt
gaaagagtaattctacctgggatgacacactggcattcacctcatttttacgcatatttt
cccgctgccccatcgtatgcatccatcgttggtgaattgctatgcgctggattaggaggc
gttggtttttcttggatatgttcacctgtttttacagaattagaagttatcacattaaat
tggcttggaaaaatgttaaatcttccatccgaattcttaaattgtagcaatggttccgga
ggaggtgttatacagggttccgctagtgaaactacattaatctgcttaataactgccaaa
gatcgaataactcgacgtatgaaaagtattcatcccgattgggatgtgggcatgattaga
tccaaattagtagcttatagttcagatcaggcaaactcgtccgttgaaaaagcgggactt
ttagccaccgttcagatgaaacttttgccatcagacgaaaatggaagccttcgtggtgat
acattattaaaagcaattaaaaatgatttagaaaacggtcttataccatgtttcgtttgt
gcaactttgggtactactggtacttgtgctttggataatttagatgaattaggacctatt
tgtaatcaatacgatttatggcttcatgttgatgccgcatatgtaggtgctgcatttgtt
tgtcctgaatatcgacatttgatgacaggtgttcattacgctgattcatttaacgttaat
tgtcataaatggatgctcgttaattttgattgttctgcaatgtgggtaaaagattccaaa
tatctcatcgaggcaatgaacgttgacagaatttatttggcacacgataaacaaggtgtc
acacctgaatttagacattggcaaatacaattaggacgtcgtttccgttctttaaagctt
tggtttgtattacgtcttcatgggatagaaggaatgcaacaacacataagaaatactgta
tcaatagcaaataaatttgctaaatacgttgaatctgacaaaagatttgaacttgtcacg
aatagtatgggtctaattagtttccgattaaagggagaggatgattggacacaagaactt
gttaaacgtttgactgaaaggaaacgcatttttgttattatcgctacattaaacgataaa
tatatcattcgtttttgcatatgcagtccgttatgtcaagaaaaagacattaagtttgct
tggaatgaaatcagtgaacaagccacggaaatacttcaagcgaagcaccatcctgtaaaa
gaaaatttaaatcaaccatccgtaaaatcgtatgacgatattacactcagaatagagaat
ttaagtcatgagtccaagggcatctag

DBGET integrated database retrieval system