KEGG   Polistes canadensis: 106788743Help
Entry
106788743         CDS       T05611                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
pcf  Polistes canadensis
Pathway
pcf00480  Glutathione metabolism
pcf00590  Arachidonic acid metabolism
pcf00980  Metabolism of xenobiotics by cytochrome P450
pcf00982  Drug metabolism - cytochrome P450
pcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106788743
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106788743
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106788743
   00982 Drug metabolism - cytochrome P450
    106788743
Enzymes [BR:pcf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106788743
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     106788743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3 GST_N_2 GST_N_4 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-GeneID: 106788743
NCBI-ProteinID: XP_014607770
Position
Unknown
AA seq 203 aa AA seqDB search
MPSYKLTYFAGKGLAEAIRFIFSYAGVEFEDITFDSNDWPTKIKPTTPFGQVPMLEVDGK
KISQSVAISRYLAKQFKLAGKDDWENLEIDATVDTIHDLRSKIGAYFYETNPEAKAAKLE
VAKEVVPFILERLDAQVKNNGGYFVGGALTWADLTFVALLYYLNYMMKSNIIEKYDNLTA
LEDKVLNLPGIKKWVETRPESEF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctataagttgacttacttcgcaggtaaaggtttggcagaggcaatccgtttt
attttcagctatgctggagtcgaatttgaagatattacttttgacagtaatgattggcct
actaaaataaaaccaactacgccttttggacaagtacccatgttggaagtagatggaaag
aaaattagtcaatctgttgccatcagtcgttacttggctaaacaatttaaacttgctgga
aaagacgactgggaaaatttagagatcgacgctaccgtcgacactattcatgatcttcgt
tcaaaaattggtgcttatttttatgaaactaatcctgaagctaaggctgcaaaattagag
gtagctaaggaagtagtaccattcatattagaacgtttggacgctcaagtaaaaaataat
gggggttacttcgttggcggtgctttgacttgggcagatcttacttttgttgctctattg
tattatcttaactacatgatgaaatcaaatatcattgagaaatatgataatctcacagca
ttggaggacaaggttcttaatcttccaggtatcaaaaaatgggtcgagacgcgtcccgaa
tctgaattctaa

DBGET integrated database retrieval system