KEGG   Polistes canadensis: 106790903Help
Entry
106790903         CDS       T05611                                 

Definition
(RefSeq) annexin B9-like isoform X1
  KO
K17095  annexin A7/11
Organism
pcf  Polistes canadensis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcf04147]
    106790903
Exosome [BR:pcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106790903
  Exosomal proteins of other body fluids (saliva and urine)
   106790903
  Exosomal proteins of colorectal cancer cells
   106790903
  Exosomal proteins of bladder cancer cells
   106790903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 106790903
NCBI-ProteinID: XP_014611634
Position
Unknown
AA seq 323 aa AA seqDB search
MSPTQYYHVQCTPTVYPADPFNTEEDAALLRTAMKGFGTDEQTIIDVLAHRGIVQRMEIA
EKFKTMYGKDLISELKSELGGNFEKAIVALMTPLPEFYAKELHDAISGMGTDEGALIEVL
ASLSNYGVKTIAAVYKELYGSELEDDLKSDTSGHFKRLLVSLSCANRDESSEVDLAAATE
DAEKLLSAGEEQWGTDESTFNAVLITRSFPQLRQIFKEYERLAGHSLEEAIKQEFSGSLE
DGYLAVVKCARDKTAYFAERLYKAMNGIGTTDSTLIRIIVARSEIDLGDIKEDYQKIYGT
SLAGDIDSDCSEDFKRLLIALLN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccactcagtattatcacgtgcagtgcacgccgaccgtctatccggctgaccct
ttcaacaccgaggaagatgcagctctgttgagaacagcgatgaagggttttggtaccgat
gaacaaacaattatcgatgtccttgctcatcgtggaattgttcaacgtatggaaattgcg
gaaaaatttaaaacgatgtacggcaaagatctaatctccgaattgaaatccgaacttggc
gggaattttgaaaaagctattgtcgccttgatgacacctctgccagaattttatgccaaa
gaattgcacgatgcaatttctggaatgggtacggatgaaggtgcactcattgaagttctt
gcatctctcagcaattatggcgtcaaaacgatagctgctgtttacaaagagttatatggc
tctgaattggaggatgacctcaaaagtgatacttccggtcatttcaagaggcttctagtt
tcactatcatgcgcaaacagagatgaaagttcggaagttgacttagcagccgcaacagag
gatgcagagaaattattatctgctggtgaagaacaatggggaactgatgagagtacattt
aacgctgtactgattacaagaagtttcccacaattaagacaaatttttaaagaatacgaa
cgccttgctggccattccttggaagaagctatcaaacaagaattttcaggttctctagaa
gatggttatctcgcagttgtgaaatgcgctcgagataaaactgcatactttgcagaaaga
ctttacaaagctatgaatggaattggtacgactgattcaactttaatacgaataatagta
gctagatcagaaattgatttgggtgacatcaaggaggattatcaaaagatttatggaaca
tcgcttgcaggtgacatcgatagcgactgcagcgaagactttaaacgacttctgatcgca
cttttgaattaa

DBGET integrated database retrieval system