KEGG   Polistes canadensis: 106792463Help
Entry
106792463         CDS       T05611                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL3
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
pcf  Polistes canadensis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcf03019]
    106792463
Enzymes [BR:pcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     106792463
Messenger RNA biogenesis [BR:pcf03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     106792463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 TBPIP ATP-cone BCIP
Motif
Other DBs
NCBI-GeneID: 106792463
NCBI-ProteinID: XP_014614381
Position
Unknown
AA seq 550 aa AA seqDB search
MSDAFEEIQAIKIKRNSLREKLQKRKRERHELFTLTSSIPSTSTADSPLPGDSNTSSKSD
HNEYERDILCILHESLPNLPITSAEIIDQLRKNLNADVSTSDIHKILEKLAAQDIIKIKE
VTENEVFGYTVLSVAESQSSCLSQSDDTENPESAETSASELNDYMPSEKQIKIDKKNTED
IMSLISMPTIREKESKKVGEQILDLLSKQTSKEKSLAERFRSQGGAQVMEFCPHGTRVDC
AKLNGGPGFAEKCKKLHFKKIIQSHTDESLGDCSFLNTCFHMDTCKYVHYEVDGPTAQTK
ETNDSDGINNATINKTLNPDNKNGSNTSCTSSVGSELTLYPPQWIQCDLRYLDMTVLGKF
AVIMADPPWDIHMELPYGTMSDDEMRQLGIPALQDEGLLFLWVTGRAMELGRECLQLWGY
ERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPRINKGLDSDVIVAEVRAT
SHKPDEIYGIIERMSPGTRKIELFGRPHNVQPNWITLGNQVDGVHLIDPQLIKAFKKRYP
DGNSMKPTKS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcttttgaagaaattcaagcaattaaaattaaaaggaatagtttacgtgaa
aaattacaaaagcgaaaaagagagagacatgaattatttactcttacttcttccatacca
tctacctcaactgctgattcacctcttcctggtgattccaatacatcttcaaaatctgat
cataatgaatatgaaagagatattctttgtatattacatgagtctttaccaaatctacca
attacatctgcggaaataatagatcaacttcgtaaaaatctgaatgcagatgtgtctact
tctgatatccataaaattttagagaaactagctgcacaagatattattaaaatcaaagag
gtcacggaaaatgaagtctttggatatacagttctctctgttgcagaatcacaatcatca
tgtctctctcaatctgatgacacagaaaatcctgagagtgcagaaacatccgcatctgaa
ttaaatgattatatgccttcagaaaaacagataaaaatagataaaaaaaatacagaggat
ataatgtcattgatctcaatgcccacaattagagaaaaagaaagtaaaaaagtaggagaa
caaatcttggatcttttgtcaaaacaaacatctaaagaaaaatcgttagcagaaagattt
cgttctcaaggcggtgcacaagttatggaattttgtccacatggaacaagagtcgattgt
gccaaattaaatggtggcccaggttttgcagaaaaatgtaagaaattacattttaaaaaa
attatacaaagtcacacagatgaatcattaggagattgtagttttcttaatacttgtttt
catatggatacatgcaaatatgtccattatgaagtagatggccctactgcacaaacaaaa
gaaacaaatgattctgatggtattaacaatgctactattaacaagacattaaatcctgat
aataaaaatggtagtaacactagttgtacaagtagtgtaggtagcgagttaactctttat
ccaccacaatggatacaatgtgatttacgatacctagatatgacagttctcggtaaattt
gctgtgattatggctgatccgccatgggacattcatatggaattaccatatggtacaatg
tcagatgatgaaatgaggcaattaggaatacctgcacttcaagatgaaggacttttattt
ttatgggtaacaggaagagcaatggaattaggaagagaatgtcttcaactatggggttac
gaaagagttgatgaaattatttgggtaaaaacaaatcaattacagagaattataagaact
ggaagaacaggacattggttgaatcatggaaaagaacactgtttagtgggtatgaaagga
aatccacgtattaataagggattagacagtgatgtaattgtagcagaagttcgtgcaact
agtcacaaaccagatgaaatttatggtattattgaacgcatgagtcctggaacaagaaaa
atagaattatttggtcgtccacacaatgtacaacctaattggataacacttggtaatcaa
gtagatggagtacatttgattgatccacaattaattaaagcctttaaaaaacgttacccc
gatggaaattcaatgaaacctacaaaatcttaa

DBGET integrated database retrieval system