KEGG   Pseudomonas corrugata: AXG94_00185Help
Entry
AXG94_00185       CDS       T04842                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pcg  Pseudomonas corrugata
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AXG94_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOE65208
Position
complement(43006..44616)
Genome map
AA seq 536 aa AA seqDB search
MTTPTFVSDSISPISRPQLNRKPSMLTLIVFFAVLASGLLFTTYSLVRDMGEFGTVVTTW
TPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTNSMAPNFAVAWSGFFNFLGVLLSSG
AVAFGIIALLPVELILQVGSSAGFAMIFALLIAAILWNLGTWWLGLPASSSHTLIGSIIG
VGVANALMHGRDGTSGVDWTQAAKVGYALLLSPLVGFGCAALLLLALRAFVKNRALYKAP
QGHEPPPWWIRGMLIATCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPADQA
LQFAAVAEVTQQALVKSAPQPAPADPRAVLSDFVRSKEASPQLVPALAALTGAIGAQVKG
YGSLARVPAEAVGNVRNDMYLTSETIRLMDKNKVTKFDADTSGKLQLFKQQIDNSTRFIP
LWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKSHLTYAQGASAETVAMLTIGAADMFGLP
VSTTHVLSSGVAGTMVANGSGLQMRTIRNLLMAWVLTLPAAILLSGSLYWLLTKLF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgaccttcgtctcagattccataagccccatctcaagaccgcagctcaac
cgcaagccgagcatgctgaccctgatcgtatttttcgcagtgttggccagcgggctgctg
ttcacgacctacagcctggtgcgtgacatgggcgaattcggcaccgtggtgaccacctgg
acgccgttcctgctgctgggcgtggcgctgctgattgccctgggcttcgagttcgtcaac
ggtttccacgacaccgccaacgccgtggcgacggtgatctacacgaactccatggcgccg
aatttcgcggtggcctggtcggggttcttcaattttctcggagtgctgttgtccagcggc
gcggtggccttcggcatcatcgccctgttgccggtagagttgattctgcaagtcggttca
tcggctggtttcgcgatgatcttcgccctgctgatcgccgcgatcctgtggaacctcggc
acctggtggctgggcctgccggcgtcctcctcgcacaccttgatcggctcgatcatcggc
gtcggcgtggccaatgccctgatgcacggccgtgacggcaccagcggggtggactggacc
caggcggccaaggtcggttacgccctgttgctctcgcccctggtgggtttcggctgtgcc
gcgttgctgttgctggcgttgcgagctttcgtcaagaaccgcgctctgtacaaggcaccg
caaggccatgagccgccaccgtggtggattcgcggcatgctgatcgccacctgcaccggc
gtgtcgtttgcccatggctccaacgacggccagaaaggcatggggctgatcatgttgatt
ctggtgggcactctgccgatggcgtatgcgttgaaccgcaccatgccagccgatcaagcc
ttgcagttcgctgccgtggccgaagtcacccagcaggccctggtaaaaagcgcaccgcaa
ccggcaccggcagatccccgggcggtcctctccgatttcgtgcgcagcaaggaagcctcg
ccgcaattggtgccggccctcgccgccctcaccggcgccatcggggcgcaggtcaagggt
tacggctcgttggccagggtgcccgccgaagccgtgggtaacgtgcgtaacgacatgtac
ctgaccagcgaaaccatccgcctgatggacaagaacaaagtcaccaaattcgatgcggac
accagcggcaagctgcaattgttcaagcagcagatcgacaattccacacggttcattccg
ctgtgggtgaagatcgccgtggccatcgccttgggcttgggcaccatggtgggctggaaa
cggatcgtggtgacggtgggcgaaaagattggcaagagccacctgacctacgcccagggc
gcctcggcggaaaccgtcgcgatgctgaccatcggcgctgccgacatgttcggcttgccg
gtgtccaccacccatgtgttgtcttcgggggtggccgggaccatggtcgccaatggttcg
ggattgcagatgcgcacgatccgtaacctgctgatggcttgggtattgacgttgccggcg
gcgattctgctgtcgggtagcctctactggctattgaccaaattgttctga

DBGET integrated database retrieval system