KEGG   Pseudomonas corrugata: AXG94_06915Help
Entry
AXG94_06915       CDS       T04842                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00071  Fatty acid degradation
pcg00072  Synthesis and degradation of ketone bodies
pcg00280  Valine, leucine and isoleucine degradation
pcg00310  Lysine degradation
pcg00362  Benzoate degradation
pcg00380  Tryptophan metabolism
pcg00620  Pyruvate metabolism
pcg00630  Glyoxylate and dicarboxylate metabolism
pcg00640  Propanoate metabolism
pcg00650  Butanoate metabolism
pcg00900  Terpenoid backbone biosynthesis
pcg01100  Metabolic pathways
pcg01110  Biosynthesis of secondary metabolites
pcg01120  Microbial metabolism in diverse environments
pcg01130  Biosynthesis of antibiotics
pcg01200  Carbon metabolism
pcg01212  Fatty acid metabolism
pcg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXG94_06915
   00630 Glyoxylate and dicarboxylate metabolism
    AXG94_06915
   00640 Propanoate metabolism
    AXG94_06915
   00650 Butanoate metabolism
    AXG94_06915
  Lipid metabolism
   00071 Fatty acid degradation
    AXG94_06915
   00072 Synthesis and degradation of ketone bodies
    AXG94_06915
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXG94_06915
   00310 Lysine degradation
    AXG94_06915
   00380 Tryptophan metabolism
    AXG94_06915
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXG94_06915
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXG94_06915
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AXG94_06915
Enzymes [BR:pcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXG94_06915
Exosome [BR:pcg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXG94_06915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOE65273
UniProt: A0A1B3CJQ7
Position
complement(1703055..1704260)
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDALRTPRGKGKADGALYSVKPVNLVGGLLQALQQRMDLDTSQVDDVVLGCVTP
VGEQGADIAKTAVLMAGWDVSVAGVQLNRFCASGLEAVNLAAMKVRSGFEDLVVAGGVES
MSRVPMGSDGGAWALDPQSNLQGHFVPQGIGADLIATLEGFSREDVDAYALNSQKKAGRA
RADGAFEKSLVAVRDQNGIVLLDHDEFIRVDSTLEGLGRLKPSFEAMGQMGFDATALRVY
SHVERIXHVHTPGNSSGIVDGAALMLIGSEAKGRALGLRPRARVVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVQDIDLFEVNEAFASVVLKFIKDMAIDPARVNVNGGAIAMGHPLG
ATGCAILGTLLDELEVRRLRYGLATLCVGGGMGIATVIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagcgttgattttcgatgccttgcgcacaccccgtggcaagggcaaggctgat
ggtgcgctgtacagcgtcaagccggtgaacctggtgggagggttgcttcaggccttgcag
cagcgcatggatctggacaccagccaggtcgatgacgtcgtgctcggttgcgtgacaccg
gtaggcgagcagggggctgacattgccaagaccgccgtcttgatggccggttgggatgtc
agtgtggcgggtgtccagctcaatcggttttgcgcctcgggccttgaagcggtgaacctg
gccgccatgaaagtgcgctccgggttcgaagacctggtggtggccggtggtgtcgagtcg
atgtcccgggtgccaatgggaagcgacggcggtgcgtgggcgctggatccgcaatccaac
ttgcagggtcacttcgttcctcaaggcatcggtgccgacctgatcgccacgctggaaggc
ttcagtcgcgaagacgtcgatgcctatgcgctgaactcccagaaaaaagccgggcgggcc
cgggctgatggcgctttcgagaaatccctggtggcagtacgggatcagaacggcatcgtg
ctgctggatcatgacgaattcatccgcgtcgattccacccttgaaggcctgggcaggctc
aagccaagtttcgaagccatgggccagatgggcttcgacgccacggcgttacgggtctac
agccatgtcgagcggatcgancatgtgcacacacccggcaacagctccgggatcgtcgat
ggggcggcactgatgctgatcggctccgaggccaagggacgtgccctgggcctgcggcct
cgagcgcgggtcgtcgccacggctgtcaccagcaccgatccgaccatcatgctcaccggg
ccggcgccggccacccgcaaagccttggccaaggccgggttgcgggtgcaggacatcgac
ttgttcgaggtcaacgaagccttcgcctcggtagtactcaagttcatcaaggacatggcc
atcgaccccgccagggtcaacgtcaacggtggcgccatcgccatgggacatcccttgggg
gcaacggggtgtgccattctcggcaccctgctcgatgagttggaggtgcgtcgcctgcgc
tacgggctggcgaccttgtgtgtgggcggcggcatgggcattgccactgttatcgaacgc
ctctga

DBGET integrated database retrieval system