KEGG   Pseudomonas corrugata: AXG94_08710Help
Entry
AXG94_08710       CDS       T04842                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pcg  Pseudomonas corrugata
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXG94_08710
Enzymes [BR:pcg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AXG94_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AOE61835
UniProt: A0A3M3EUN8
Position
complement(2069841..2070704)
Genome map
AA seq 287 aa AA seqDB search
MNVDLHCHSTASDGALAPAIVVARAFEHGVRVLALTDHDTLEGLDEARNTATALGMQLIN
GVELSCTWGGATIHVLGYGFDVDAPPLVQAIAQLRDGRWLRAEEISRKLALKGMPGALEG
ARQIQQELGDSGNAPARPHFADWMVREGFVKDRAEAFRKWLGAGKLGDVKQHWPSLEQTV
ETLRASGAWVSLAHPWHYDFTRSKRRRLIADYIQAGGHAIEVVNGHQPAEQVGSLAILAR
EFGLLVTAGSDFHGPGGWSEIGEYRPLPEDLPPLWCRFKHELVTDAV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgttgatttgcactgccatagcacggcctccgatggcgccctggcgcctgcgatt
gtggtggcgcgggcgttcgagcacggcgtgcgagtcctggccctgaccgatcatgacacc
ctcgaaggcctcgacgaggcccgcaatacggcgacggcgttgggcatgcaactgatcaac
ggcgtcgaattgtcctgcacctggggcggggcgaccatccatgtgctgggctacggtttc
gatgtcgacgcgccgccgctggtccaggccatcgcccaattgcgcgacggtcgctggctg
cgtgccgaggagatcagccgcaaactggccctcaagggcatgcccggtgcgctggagggt
gcccggcagatccagcaggagctgggtgacagcggtaacgcaccggcacggccgcacttc
gccgactggatggtgcgcgaaggtttcgtcaaggaccgtgccgaagcgttccgcaaatgg
ctgggggccggcaagctaggggatgtcaagcagcattggccctccctggaacagacggtt
gaaaccctgcgggcctcgggggcctgggtcagcctggcgcatccgtggcactatgatttc
acccgaagcaaacgtcgccgccttatagccgactatattcaagcagggggccacgccatt
gaggtggtcaatggccatcagccggccgagcaggtcggcagtctggcgattctggcccgg
gagtttggcctgctggtcaccgccggcagtgatttccatggcccaggaggctggtccgag
atcggcgaataccgtccgttacccgaagatctgccaccgctttggtgtagattcaaacat
gaacttgttaccgacgccgtctga

DBGET integrated database retrieval system