KEGG   Pseudomonas corrugata: AXG94_12365Help
Entry
AXG94_12365       CDS       T04842                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pcg  Pseudomonas corrugata
Pathway
pcg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AXG94_12365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pcg03011]
    AXG94_12365
Ribosome [BR:pcg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AXG94_12365
  Bacteria
    AXG94_12365
  Archaea
    AXG94_12365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOE62524
UniProt: A0A3M3DTN6
Position
complement(2871447..2871779)
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcagt
aagaaagccgccgagatcatgaaaaaagtgctggagtcggccgtagccaacgccgagcat
aacgaaggcgcagacgttgatgacctgaaagtcagcaccgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgccacgtgccaaaggccgtgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system