KEGG   Pseudomonas corrugata: AXG94_13030Help
Entry
AXG94_13030       CDS       T04842                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00625  Chloroalkane and chloroalkene degradation
pcg00680  Methane metabolism
pcg01100  Metabolic pathways
pcg01120  Microbial metabolism in diverse environments
pcg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AXG94_13030
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXG94_13030
Enzymes [BR:pcg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AXG94_13030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD PALP FAD_binding_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AOE62641
UniProt: A0A3M3EB91
Position
complement(3019066..3020265)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGNGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNSIRLAHAKAQGFEVVDLSTD
TPLHEQIAALLGEPEVDCAVDCVGFEARGHGHDGVKHEAPATVLNSLMQVTRVAGKIGIP
GLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRINIA
EIVGVQVISLDDAPKGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtaatcgtggtgtcgtgtatctcggcaacggcaaggtcgaagtccagaagatc
gactatccaaaaatgcaggacccgcgtggcaggaagatcgagcacggcgtcatcctgcgc
gtggtatccaccaacatctgcggctccgaccagcacatggtgcgcggccgtaccaccgcc
cagaccggcctggtcctgggtcatgagatcaccggtgaagtgatcgagaagggcagcgac
gtcgagaacctgaagatcggtgacctggtgtcggtaccgttcaacgtcgcgtgcggtcgt
tgccgttcctgcaaggaacagcacaccggcgtctgcttgaccgtcaacccggctcgtgcc
ggtggcgcctacggttatgtcgacatgggcgactggaccggcggccaggccgagtacgtg
ctggtgccgtacgctgacttcaacctgctgaaactgccggaccgcgacaaggccatggag
aagatccgtgacctgacctgcctgtccgacatcctgcctaccggttaccacggtgcagtg
actgccggcgttggtcctggcagcaccgtatacattgctggcgctggcccagtcggcctg
gctgctgcggcttctgctcgtctgctcggtgcagcggtggtgatcgtcggtgacgtcaac
tccatccgtctggctcacgccaaggcgcagggttttgaagttgtcgacctgtccaccgac
acaccattgcacgagcaaatcgccgcgttgttgggcgaacctgaagtcgattgcgccgtt
gactgcgtaggcttcgaagcccgtggtcatggtcatgacggcgtcaagcacgaagccccg
gccaccgtgctcaactctttgatgcaagtgacccgtgtcgccggcaagatcggtatccct
ggcctgtacgtcaccgaagatccgggcgcggtcgatgccgccgccaagatcggtgccctg
agcatccgtttcggcctcggctgggccaagtcccacagcttccacactggccagacccca
gtgatgaagtacaaccgtgcgctgatgcaggcgatcatgtgggaccgcatcaacatcgcg
gaaatcgtcggcgtacaggtcatcagcctggacgacgcgccgaaaggctacggcgagttc
gacgctggcgtgccgaagaaattcgtgatcgacccgcacaagctgttcagcgcggcgtaa

DBGET integrated database retrieval system