KEGG   Pseudomonas corrugata: AXG94_24110Help
Entry
AXG94_24110       CDS       T04842                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00480  Glutathione metabolism
pcg00590  Arachidonic acid metabolism
pcg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AXG94_24110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXG94_24110
Enzymes [BR:pcg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AXG94_24110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AOE64722
UniProt: A0A3M3E954
Position
5509421..5509906
Genome map
AA seq 161 aa AA seqDB search
MSDNLLSIPCTTIKGEQKTLADFAGKAVLVVNTASQCGFTPQYKGLEQLWQTYKDQGLVV
LGFPCNQFGKQEPGNEGAISEFCELNFGVSFPLFKKIEVNGANAHPLFVQLKQRAPGVLG
SKGIKWNFTKFLVGKDGQVVKRFAPTTKPQDLTHEIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacctgctgagcattccctgcaccaccatcaagggtgagcaaaagaccctg
gccgatttcgccggcaaggccgtgctggtggtcaacactgccagtcagtgcggtttcacc
ccgcagtacaaggggcttgagcagttgtggcagacctacaaggatcagggcctggtggta
ttgggcttcccctgcaatcagttcggcaagcaggagccgggcaatgaaggggcgatttcc
gagttctgcgagctgaacttcggcgtgagttttccgctgttcaagaaaatcgaggtcaat
ggtgccaacgcccatccgctgtttgtccagctcaagcagcgggcacccggtgtgctgggg
tccaagggcatcaagtggaatttcaccaagttcctggtcggcaaggacggtcaagtggtc
aagcgttttgctccaaccaccaaaccccaggacctgacccatgagatcgaagccctgctc
aaatga

DBGET integrated database retrieval system