KEGG   Pseudomonas chlororaphis PA23: EY04_08800Help
Entry
EY04_08800        CDS       T03201                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch00071  Fatty acid degradation
pch00072  Synthesis and degradation of ketone bodies
pch00280  Valine, leucine and isoleucine degradation
pch00310  Lysine degradation
pch00362  Benzoate degradation
pch00380  Tryptophan metabolism
pch00620  Pyruvate metabolism
pch00630  Glyoxylate and dicarboxylate metabolism
pch00640  Propanoate metabolism
pch00650  Butanoate metabolism
pch00900  Terpenoid backbone biosynthesis
pch01100  Metabolic pathways
pch01110  Biosynthesis of secondary metabolites
pch01120  Microbial metabolism in diverse environments
pch01130  Biosynthesis of antibiotics
pch01200  Carbon metabolism
pch01212  Fatty acid metabolism
pch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EY04_08800
   00630 Glyoxylate and dicarboxylate metabolism
    EY04_08800
   00640 Propanoate metabolism
    EY04_08800
   00650 Butanoate metabolism
    EY04_08800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EY04_08800
   00072 Synthesis and degradation of ketone bodies
    EY04_08800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EY04_08800
   00310 Lysine degradation
    EY04_08800
   00380 Tryptophan metabolism
    EY04_08800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EY04_08800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EY04_08800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EY04_08800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pch04147]
    EY04_08800
Enzymes [BR:pch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EY04_08800
Exosome [BR:pch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EY04_08800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIC18994
Position
1947158..1948363
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDALRTPRGKGKADGALHSVKPVNLLAGLLDALQRRSELDTSQVDDIVLGCVTP
IGDQGADIAKTAALVADWDVSVAGVQINRFCASGLEAVNLGAMKVRSGFEDLVVVGGVES
MSRVPMGSDGGAWVLDPQTNMHSHFTPQGIGADLIATLEGFSREDVDSFALQSQQKAARA
RAAGAFSKSLVPVQDQNGIVLLDHDEFIRADSTLEGLGKLKPSFEMIGQMGFDATALRVY
SHVERIHHVHTPGNSSGIVDGAALMLIGSEAKGQALGLKPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMAIDPGKVNVNGGSIAMGHPLG
ATGCAILGTLLDELEARRQRYGLATLCVGGGMGIATIIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctttgatattcgatgcattacgcaccccccgtggcaaaggcaaggccgat
ggcgccttgcacagcgtcaagccggtgaacctgctggccgggctgctcgatgccctgcag
cggcgtagcgaactcgacaccagccaggtcgacgacatcgtgctcggctgtgtgacgccg
atcggcgaccagggggccgacatcgccaagaccgcggcgctggtcgccgactgggacgtc
agcgtggccggggtgcagatcaaccgcttttgcgcctcgggcctcgaggcggtgaacctg
ggggcgatgaaagtgcgctccggcttcgaggacctggtggtggtcggcggcgtcgagtcg
atgtcacgggtgcccatgggcagcgacggcggcgcctgggtgcttgacccgcaaaccaac
atgcacagccatttcaccccgcaaggcataggcgcggacctgatcgccaccctggaaggc
ttcagccgcgaggatgtcgacagctttgccctgcaatcccagcaaaaggccgcgcgggcc
agggcggcaggagctttcagcaagtccctggtgccggtgcaagaccagaatggcatcgtc
ctgctggatcacgatgaattcattcgcgccgattccaccctcgagggcctgggcaagctc
aagcccagcttcgagatgatcggccagatgggcttcgacgccaccgccttgcgggtctac
agccatgtcgagcgcatccaccacgtgcacaccccgggcaacagctcagggatagtcgac
ggtgcggcgctgatgctgatcggctccgaagccaagggccaggcgctgggcctcaagccg
cgggcgcggatcgtcgccacggcggtcaccagcaccgatccgaccatcatgctcaccggg
ccggcgccggccacgcgcaaggcactggccaaggccgggctgcgggtcgaggacatcgac
ctgttcgaggtcaacgaggcgttcgcctcggtggtgctgaagttcatcaaggacatggcc
atcgaccctggcaaggtcaacgtcaatggcggctccatcgccatgggccatccgctgggc
gccaccggctgcgcgatcctcggcaccctgctcgacgagctggaagcgcggcgccagcgt
tacggcctggcgaccctctgcgtcggtggcggcatgggtatcgccaccatcatcgaacgc
ctctga

DBGET integrated database retrieval system