KEGG   Pseudomonas chlororaphis PA23: EY04_09295Help
Entry
EY04_09295        CDS       T03201                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pch  Pseudomonas chlororaphis PA23
Brite
KEGG Orthology (KO) [BR:pch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pch03009]
    EY04_09295
Enzymes [BR:pch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     EY04_09295
Ribosome biogenesis [BR:pch03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EY04_09295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AIC19090
Position
2064723..2065796
Genome map
AA seq 357 aa AA seqDB search
MNTLFMHCRPGFEGEVCSEIADHAARLNVAGYAKAKPSTACAEFVCSEEDGAERLMRELR
FAELIFPRQWARGVFVDLPETDRISVILAHLASFPTCGSLWLEVLDTNDGKELSNFCKKF
EAPLRKALTAAGKLVDDAGKPRLLLTFKSGREVFVGLADAGNSAMWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRDQWDERLHGDMTGVDLGAAPGGWTWQLVNRGMLVTAVDNGPMA
ESLMDTGLVQHLMADGFTFKPKQPVDWMVCDIVEKPARNAALLETWIGEGHCREAVVNLK
LPMKQRYAEVKRLLERIEDGFKARGIRVAIGCKQLYHDREEVTCHLRRLDEKKPKAR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctctttatgcactgccggccgggcttcgaaggcgaagtctgctccgagatc
gccgaccatgccgcgcgcctgaacgtggccgggtacgccaaggccaagccgagcaccgcc
tgtgccgagtttgtgtgcagcgaagaagacggcgccgagcgcctgatgcgcgagctgcgt
tttgccgagctgatctttccgcgacagtgggcgcggggcgtcttcgtcgatctgccggaa
accgaccgcatcagcgtgatcctggcccatctggcgagtttcccgacctgcggcagcctg
tggctggaagtgctggataccaatgacggcaaagaactgtcgaacttctgcaagaaattc
gaagcgccactgcgcaaggcgctgacggcggccggcaagctggtggacgatgccggcaag
ccacgcttgctgctgaccttcaaaagcggccgcgaggtgtttgtcggcctggccgatgcc
ggcaattcggccatgtggccgatgggcattccgcgcttgaagttccctcgtgaagcgccc
agccgctcgaccctgaagctggaggaggcctggcaccacttcattcctcgcgatcagtgg
gacgagcgcctgcacggcgacatgaccggcgtcgacctcggtgccgccccgggtggctgg
acctggcaactggtcaaccgcggcatgctggtcaccgctgtcgacaacgggccgatggcc
gaaagcctgatggacaccggcctggtgcagcacctgatggccgacggtttcaccttcaaa
cccaagcagccggtggactggatggtctgcgacatcgtcgagaaaccggcgcgcaacgcc
gccttgctggaaacctggatcggcgaggggcattgccgcgaagcggtggtcaacctgaaa
ctgccgatgaagcagcgttacgcggaagtgaagcgtttgctcgaacggatcgaagacggc
ttcaaagcccgtggcattcgcgtggcgatcggctgcaagcagctgtaccacgaccgtgaa
gaagtgacctgccacctgcgccggctggatgaaaagaagcccaaggcacgttga

DBGET integrated database retrieval system