KEGG   Pseudomonas chlororaphis PA23: EY04_24795Help
Entry
EY04_24795        CDS       T03201                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch00220  Arginine biosynthesis
pch01100  Metabolic pathways
pch01110  Biosynthesis of secondary metabolites
pch01130  Biosynthesis of antibiotics
pch01230  Biosynthesis of amino acids
Module
pch_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EY04_24795
Enzymes [BR:pch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     EY04_24795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AIC22014
UniProt: A0A3G7TUK4
Position
5469196..5470116
Genome map
AA seq 306 aa AA seqDB search
MSARHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRLSF
EAGMIQLGGQAIFLSPRDTQLGRGEPISDCAIVMSRMLDAVMIRTFAHRTLTEFAANSRV
PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRI
ACPEGYDPNPEFVARAGDRVSIVRDPKDAVIGAHLVSTDVWTSMGQEEETAERLKLFAPF
QVNRALLDLAAADVLFMHCLPAHRGEEISLDLLDDPRSVAWDQAENRLHAQKALLEFLVE
PAYHHA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaggcactttctctccctgatggattgcacgcccgaagagctggtcagcgtg
attcgtcgaggcatcgagctgaaggacctgcgtaatcgcggcgtactcttcgagcctctg
aaaaatcgcgttctcgggatgattttcgagaagtcgtctacccgcacccgcctgtccttc
gaagccggcatgatccagctcggcggccaggcaatcttcctgtccccgcgcgacacccag
ctgggtcgcggcgagccgatcagcgactgcgccatcgtcatgtcgcgcatgctcgacgcg
gtgatgatccgtacctttgcccaccgcaccctgaccgagtttgcggccaactcccgcgta
ccggtgatcaacggcctgtccgacgacctgcacccgtgccagctgctggccgacatgcaa
accttcctcgaacaccgcggctcgatccagggcaagaccgtggcctggatcggcgacggc
aacaacatgtgcaacagctatatagaagcggcgatccagttcgacttccaactgcgcatc
gcctgccccgaaggctacgaccccaaccctgaattcgtcgcccgcgccggcgatcgggtg
agcatcgtgcgcgatccgaaagacgcggtgatcggcgcccatctggtaagcaccgacgtc
tggacctccatggggcaggaagaagaaaccgccgagcgcctcaagctgttcgcgccgttc
caggtcaatcgcgcgctgctcgacctggccgccgcagacgtgctgttcatgcactgcctg
cctgcccaccgtggcgaagaaatcagcctcgacctgctggacgatccacgctccgtggca
tgggaccaggcagaaaaccgtctccacgcacaaaaggccctgctcgagtttctggtcgag
ccggcgtaccaccacgcatga

DBGET integrated database retrieval system