KEGG   Pseudomonas chlororaphis PA23: EY04_32340Help
Entry
EY04_32340        CDS       T03201                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
pch  Pseudomonas chlororaphis PA23
Brite
KEGG Orthology (KO) [BR:pch00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EY04_32340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIC23443
UniProt: A0A0E1EEA2
Position
complement(7082069..7082449)
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVVTRFLAEQSQPEQNRFAFAYTITVQNNGLLPAKLLSRHWVITDGDGHV
EEVRGAGVVGQQPLIAAGKSHTYSSGTVMTTRVGNMQGSYQMLAEDGKHFDAIIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctcgctatcagatcgacgtcagcgtcgtcacccgctttctcgcagaacag
tcgcaacccgagcagaaccgctttgccttcgcctacaccatcaccgtacagaacaatggc
ctgctgcccgccaaattgctctcccggcactgggtgatcaccgatggcgacgggcacgtc
gaagaagtccgcggtgccggcgtcgtcggccagcagccgctgatcgccgcaggaaaaagc
cacacctacagcagtggtacggtcatgaccacgcgcgtcggcaatatgcagggcagctat
cagatgctcgccgaagacggcaaacacttcgacgccatcatcgcccccttccgcctggcg
gtgcccggagccctgcactga

DBGET integrated database retrieval system