KEGG   Pseudomonas cichorii: PCH70_09380Help
Entry
PCH70_09380       CDS       T03002                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pci  Pseudomonas cichorii
Pathway
pci00480  Glutathione metabolism
pci00590  Arachidonic acid metabolism
pci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PCH70_09380
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PCH70_09380
Enzymes [BR:pci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PCH70_09380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: AHF66091
UniProt: W0H122
Position
1037294..1037776
Genome map
AA seq 160 aa AA seqDB search
MSAFHDITLKALNGQELPLAPLKNTVVLVVNVASKCGLTPQYAALESLYQQYKDKGFSVL
GLPCNQFAGQEPGSEQEIQEFCKLNYGVTFALGEKLEVNGAQRHPLYRLLAGEGAEFPGD
ITWNFEKFLVGRNGAVIARFSPRMAPDDPVVIQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttcacgacattacattgaaggcgctgaacgggcaggagctgcctctggcg
cctttgaagaacacagtggtcctggtcgtcaacgtggcctccaaatgcgggctcacgcca
caatatgcagcgcttgaaagcctttaccagcagtacaaggacaagggcttcagcgttctg
gggctgccgtgcaatcagtttgccggacaggagcctggttccgagcaggaaatccaggag
ttctgcaaactcaattatggcgtgaccttcgcactgggcgaaaagctcgaggtcaacgga
gcgcaacgccatccgctgtatcgtctgctggccggagagggcgccgagtttcctggcgat
atcacctggaacttcgagaagtttctggtcggtcgcaacggtgccgtgattgcccgattc
tcgccacgcatggcgccggatgatcctgtggttatccaggccatcgaaaaggccctggcc
tga

DBGET integrated database retrieval system