KEGG   Pseudomonas cichorii: PCH70_09450Help
Entry
PCH70_09450       CDS       T03002                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
pci  Pseudomonas cichorii
Pathway
pci00670  One carbon pool by folate
pci00790  Folate biosynthesis
pci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCH70_09450
   00670 One carbon pool by folate
    PCH70_09450
Enzymes [BR:pci01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PCH70_09450
    1.5.1.50  dihydromonapterin reductase
     PCH70_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AHF66098
UniProt: W0H0S6
Position
complement(1042798..1043496)
Genome map
AA seq 232 aa AA seqDB search
MNKTILVTGASQRVGLELAIQLAQAGYNVISVSRTLLENSPHPNIVQFQADLGVEQDRLA
LIDYITSNYDGLRAIIHNASLWLDDSLENLNIMFRLHVEAPYHLNLALGELLAGPEKTDI
IHICDDTSSRGSKSHIAYAATKAALQNMVLSFAEKYAPDIRVNAILPGLLILKPDSDEDY
RRQTLKKALLQFEPGAEPLIEAVFYLLEARYTTGSSVVINGGRHLKKGRSGE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaataagacaatccttgtaaccggcgccagccagcgagtcggcctggaactggccatc
cagttggcacaggcaggctataacgtcatcagtgtcagccgcaccctgctagagaattcg
cctcaccccaatatcgtgcaatttcaggctgatctgggcgtggagcaggatcgcctggcg
ctgatcgactacatcacctccaactacgatggcctgcgtgcaatcatccacaacgcttcg
ttgtggctggacgacagtctggaaaacctgaacatcatgttcaggctccatgtcgaagcg
ccttaccatttgaacctggcactgggtgagttgctggccgggccggaaaaaaccgacatc
attcatatctgcgatgacacctcgtctcgcggcagcaagagccacatcgcctatgcagcc
accaaggccgccctgcagaacatggtgctgtcgttcgccgagaaatatgcacccgacatt
cgcgtgaacgcgatcctgccggggctgctgatcctcaagccggacagcgacgaagactat
cgccgccagacgctgaaaaaggcgctgctgcaattcgagcctggcgcagagcccttgatc
gaagccgtcttctatctgctggaagcccgctacaccacaggaagcagtgtcgtcatcaat
ggtggtcgacacctgaagaaagggagatccggtgaatga

DBGET integrated database retrieval system