KEGG   Pseudomonas cichorii: PCH70_24570Help
Entry
PCH70_24570       CDS       T03002                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pci  Pseudomonas cichorii
Pathway
pci00071  Fatty acid degradation
pci00072  Synthesis and degradation of ketone bodies
pci00280  Valine, leucine and isoleucine degradation
pci00310  Lysine degradation
pci00362  Benzoate degradation
pci00380  Tryptophan metabolism
pci00620  Pyruvate metabolism
pci00630  Glyoxylate and dicarboxylate metabolism
pci00640  Propanoate metabolism
pci00650  Butanoate metabolism
pci00900  Terpenoid backbone biosynthesis
pci01100  Metabolic pathways
pci01110  Biosynthesis of secondary metabolites
pci01120  Microbial metabolism in diverse environments
pci01130  Biosynthesis of antibiotics
pci01200  Carbon metabolism
pci01212  Fatty acid metabolism
pci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCH70_24570
   00630 Glyoxylate and dicarboxylate metabolism
    PCH70_24570
   00640 Propanoate metabolism
    PCH70_24570
   00650 Butanoate metabolism
    PCH70_24570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PCH70_24570
   00072 Synthesis and degradation of ketone bodies
    PCH70_24570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PCH70_24570
   00310 Lysine degradation
    PCH70_24570
   00380 Tryptophan metabolism
    PCH70_24570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCH70_24570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PCH70_24570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PCH70_24570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pci04147]
    PCH70_24570
Enzymes [BR:pci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PCH70_24570
Exosome [BR:pci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCH70_24570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHF67610
UniProt: W0HA04
Position
2781367..2782572
Genome map
AA seq 401 aa AA seqDB search
MSIENKTPPHDPVVIVSAARTPIGGFQGDLKSLTAPQLGSAAIRAAVERVGIDPQDVEEV
LFGCVLPAGLGQAPARQAALGAGLSTSALCTTVNKMCGSGMQTAILAHDLLLAGSVSVVV
AGGMESMSNAPYLLDRARSGYRMGHGRVLDHMFFDGLEDAYEPGRLMGTYAEDCAQMNGF
SREAQDAFAVASLTRAQEAIAEGHFDAEIVPLQVTVGKEQRLISHDEQPPKALLEKIPLL
KPAFREEGTVTAANSSSISDGAAALLLMRHSEAQRRGLTPLARIHAHAAFADVPGLFPTA
PIGAITRLLGKTGWSVDDVDLFEINEAFAVVPLAAMSRLELHHEKVNISGGACALGHPVG
ASGARIIVTLLAALRRKQLKRGIAAICIGGGEATAMAVELM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgagaacaagacaccgcctcacgaccctgtcgtcatcgtcagtgccgcccga
acgcccattggcggttttcaaggagatttgaaaagcctcactgcgccgcaactgggttcg
gcagccattcgtgccgctgtcgagcgggtgggtatcgatccgcaggacgtcgaagaagtc
ctgttcggttgcgtgttgccagccggactcggccaggcgccagcgcgtcaggcggcgttg
ggggcggggttgagcacctcggccctgtgcaccaccgtcaataagatgtgcggctccggc
atgcagactgccattctggcccatgacctgctgctcgccggcagtgtcagcgtggttgtc
gcgggcggtatggaaagcatgtccaatgcgccttacttgctggatcgcgcccgcagtggc
taccggatgggtcatggacgggtactggaccacatgtttttcgacggccttgaagacgcc
tacgagccaggccggttgatgggtacgtatgccgaggattgcgcccagatgaacggtttc
agtcgcgaggcgcaggatgcctttgccgtggcttccctgacgcgcgcgcaggaagccatc
gccgaaggtcatttcgatgccgagatcgttccgttgcaggttacggtgggcaaagagcag
cgattgatcagtcacgacgaacagccgcccaaggcgctactggaaaagattccgcttctg
aaacctgcctttcgtgaggaaggcaccgtgactgccgccaactccagctccatctccgac
ggggctgcggccctgttgctgatgcgtcactccgaagcacaacgccgtggcctgactccg
ctggcaaggattcatgcccatgccgcttttgccgatgttcccggtctctttcctacggcg
ccgataggggcgattacccgcttgctgggcaagaccggctggtcggtggatgatgtggac
ctgtttgaaatcaatgaagcctttgccgtggtgccactggcggccatgagccgcctcgaa
ctgcatcacgagaaggtcaatatcagcggcggcgcctgcgcgctggggcatccggtggga
gcgtcgggtgcgcggatcatcgttaccttgctggcggcattgcgccgtaaacagctcaag
cgcggtatcgctgcaatctgcattggtggtggtgaagcaactgccatggcggtcgagttg
atgtag

DBGET integrated database retrieval system