KEGG   Pseudomonas cichorii: PCH70_34030Help
Entry
PCH70_34030       CDS       T03002                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pci  Pseudomonas cichorii
Brite
KEGG Orthology (KO) [BR:pci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PCH70_34030
Enzymes [BR:pci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     PCH70_34030
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     PCH70_34030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA DUF3151 Fae
Motif
Other DBs
NCBI-ProteinID: AHF68556
UniProt: W0H7X5
Position
4055091..4056113
Genome map
AA seq 340 aa AA seqDB search
MSERPVIGITMGDAAGVGPEIIMKTLTHASVYETCRPLVIGDAKRLEDASRIVGSNLRVN
SINSPAQARFAQGVVDCIDLGLIPADLPYGKLSPIAGDAAFRYIERTVQLTEAGELDAIC
TAPLNKEALHAGGHIFPGHTEMLAHLLGVEEVSMMLMTPILRVIHVTTHIGIIDAIARIE
PGLVKRTIERARETLVRAGIENPLIAVCGINPHAGENGLFGYGEEATKIQPAIDELRARG
WRVEGPLPADTLFFRAGRGDFDAVVAMYHDQGHGPVKVMGLEAGVNVTIGLPVIRTSVDH
GTAFDIAGKGIADERSLIEALRQAVELATRKRDTRNSIAV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgtcctgtcattggtatcaccatgggcgacgccgccggggtgggccctgaa
atcatcatgaaaaccctgacccacgcctcggtatacgaaacctgccgtccgctggtgatc
ggcgacgccaagcgccttgaagacgccagtcggatcgtcggcagcaacctgcgcgtcaac
agcatcaacagcccggcgcaggcgcgttttgcccagggcgtggtggactgcatcgatctg
ggcctgatccccgccgacctgccttacggcaagttgtcgcccatcgccggtgatgccgcc
tttcgctatatcgaacgcaccgtgcaactcaccgaagccggtgaactggatgccatctgc
accgcaccgctgaacaaggaagcgctgcatgcgggcgggcatatcttccccggccacacc
gaaatgctcgcgcacctgctgggcgtggaagaagtgtcgatgatgctgatgacccccatt
ctgcgggtcattcacgtcaccacccacatcggcatcatcgacgccatcgcacggatcgaa
ccgggtctggtcaagcgcaccatcgaacgcgcccgggaaaccctagtacgggccggtatc
gaaaacccgctgatcgcggtgtgcggcatcaacccccatgccggtgaaaacggcctgttc
ggttacggcgaagaagccaccaagatccagcccgccatcgacgaattgcgcgcacgcggc
tggcgtgtcgaaggcccgctgccggccgacacgctgttcttccgcgccggtcgcggtgac
ttcgatgccgtggtcgctatgtatcacgatcagggccatggcccggtcaaggtcatgggg
ctggaagccggcgtcaacgtcaccatcggcctgccggtgatccggacctcggtggatcac
ggcaccgctttcgacatcgccggcaaaggcattgccgacgagcgcagcctgatcgaagcc
ctgcgccaggccgtggaactggccacccgtaaacgcgacacccgcaattccatcgccgtc
tga

DBGET integrated database retrieval system