KEGG   Pseudomonas cichorii: PCH70_42990Help
Entry
PCH70_42990       CDS       T03002                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pci  Pseudomonas cichorii
Pathway
pci00970  Aminoacyl-tRNA biosynthesis
pci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pci00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PCH70_42990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pci03029]
    PCH70_42990
Enzymes [BR:pci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PCH70_42990
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PCH70_42990
Mitochondrial biogenesis [BR:pci03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PCH70_42990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHF69452
UniProt: W0HEY5
Position
5018679..5020130
Genome map
AA seq 483 aa AA seqDB search
MHQMTLAEIARGLADKKFSSEELTRVLLARIAQLDPQLNSFITLTEDLAITQAQAADARR
AGGENGALLGAPLAHKDLFCTQGIRTSCASRMLDNFKAPYDATVVARLAAAGTVTLGKTN
MDEFAMGSANESSYYGAVKNPWALEHVPGGSSGGSAAAVAARLLPAATGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQAGPMARTAEDCALLLQGMAGFDPQDSTSIDE
PVPDYSASLNTSLKGLRVGLPKEYFSAGLDPRIAQRVHETVKELEKLGAIVKEISLPNNQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCEEPKDLTDLYKRSRAEGFGPEVQRRIMVGA
YALSAGYYDAYYLQAQKIRRLIKNDFMNAFAEVDVILGPTTPNPAWKIGAKNNDPVSAYL
EDFYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQQVTDWHTRTP
EGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaatgactctggccgagatcgcccgcggactcgccgataaaaagttttcctcc
gaagaactgacccgtgtcctgctggcgcgcatcgcgcagctcgaccctcagctcaacagc
ttcattactctcaccgaagacctggcgatcactcaggcccaggctgccgacgcacgtcgc
gctggcggtgagaacggcgccctgctgggcgcgcctctggcgcacaaggacctgttctgc
acccagggcatccgcaccagttgcgcctcgcgcatgctcgacaacttcaaggcaccgtac
gacgccaccgtagttgcccgactggcggccgcgggcaccgtgacacttggcaagaccaac
atggacgaattcgccatgggttcggccaacgagtccagctactacggcgcggtgaaaaac
ccctgggctctggagcacgttcccggcggttcgtccggcggttcggcggctgccgttgcg
gcacgcctgctgcctgcggccaccggcaccgacaccggcggctcgattcgccagccagcc
gcactgaccaacctgaccggcctgaaaccgacctacggtcgcgtttcccgctggggcatg
atcgcctacgcgtccagcctcgatcaggctggccccatggcccgcactgccgaagactgt
gccctgctgctgcaaggcatggccggcttcgatccgcaggactccaccagcatcgatgag
cctgtgccggattactccgccagcctcaatacctcgctcaagggcctgcgcgtcggcctt
ccgaaagagtacttcagcgcaggtctggaccctcgcatcgcacagcgggtacacgaaacc
gtcaaggagctggaaaagctcggcgcgatcgtcaaggaaatcagcctgccgaacaaccag
cacgcgattcctgcgtactacgtcatcgctccggcagaagcctcgtccaacctgtcgcgc
ttcgacggcgtacgcttcggctatcgctgcgaagagccaaaagacctgaccgacctgtac
aagcgctcccgcgccgaaggcttcggccctgaagtacagcgtcgcatcatggtcggtgcc
tacgccctgtcggctggctactacgacgcctattacctgcaagcgcagaagattcgccgc
ctgatcaagaacgacttcatgaacgccttcgccgaagtcgacgtgattctcggcccgacc
acgccaaacccggcctggaaaatcggcgccaagaacaacgatccggtttctgcgtatctg
gaagacttctacaccatcaccgccaacctcgcgggtctgccgggcctgtccatgcctgcc
ggcttcgtcgacggcctgccggtgggtgtgcaactgcttgcgccgtatttccaggaaggc
cgtctgttgaatgtggcccatcagtatcagcaagtcactgactggcacacacgcacacct
gaaggcttctga

DBGET integrated database retrieval system