KEGG   Paraburkholderia caledonica: CUJ87_05805Help
Entry
CUJ87_05805       CDS       T05740                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00230  Purine metabolism
pcj00240  Pyrimidine metabolism
pcj01100  Metabolic pathways
pcj01110  Biosynthesis of secondary metabolites
pcj01130  Biosynthesis of antibiotics
Module
pcj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pcj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pcj_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CUJ87_05805
   00240 Pyrimidine metabolism
    CUJ87_05805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcj04131]
    CUJ87_05805
Enzymes [BR:pcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CUJ87_05805
Membrane trafficking [BR:pcj04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CUJ87_05805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AXF13982
UniProt: A0A2Z5M9Y9
Position
PHRS4_A:1327136..1327561
Genome map
AA seq 141 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF
KDLVEFMISGPVVVQVLEGENAILKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD
AAETAAVEIAFFFPQVNVYSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaacgcaccctgtcgattatcaagccggacgcagtggccaagaatgtgatc
ggccagatctacagccgtttcgaaaacgctggcctgaagatcgtggcttcccgcatggtt
catctgtcgcgcgccgacgctgagaagttctacgcggtgcacgctgcacgtcctttcttc
aaggacctggtcgaattcatgatttcgggcccggtggtcgttcaggtgctggaaggcgaa
aacgctatcttgaagcaccgtgacctgatgggtgcaacggacccgaaaaaggcggaaaag
ggcacgattcgcgctgacttcgccgacagcatcgacgcaaacgcggtgcacggctccgac
gccgctgaaacggctgcagttgaaattgcatttttcttcccgcaagtgaacgtctactca
cgctaa

DBGET integrated database retrieval system