KEGG   Paraburkholderia caledonica: CUJ87_08050Help
Entry
CUJ87_08050       CDS       T05740                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00620  Pyruvate metabolism
pcj00630  Glyoxylate and dicarboxylate metabolism
pcj01100  Metabolic pathways
pcj01110  Biosynthesis of secondary metabolites
pcj01120  Microbial metabolism in diverse environments
pcj01200  Carbon metabolism
Module
pcj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUJ87_08050
   00630 Glyoxylate and dicarboxylate metabolism
    CUJ87_08050
Enzymes [BR:pcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CUJ87_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AXF14365
UniProt: A0A2Z5MAF3
Position
PHRS4_A:complement(1827517..1829688)
Genome map
AA seq 723 aa AA seqDB search
MTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNHALLAERDRL
QTELDNWHRANPGPVRDLRAYRAFLGGIGYIVPAPASVKATTDQVDTEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPETNGADRQKTFNPVRGAAVIAYARKFLDEAA
PLANGSHADATRYSVEGGKLAVALKNGTSELKTPAQFIGYQGDASAPSAVLLKHNGLHFE
IQIDANDSIGKTDAAHVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMNGDLT
EEVTKNGKTFTRRLNDDRVYVAANGTAPVVLHGRSLLFIRNVGHLMTNPAVLTKDGAEIP
EGILDAVMTTLCALHDRKHKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSVNLLACIAEASERVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKS
SAWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIAHPKAGANTAWVPSP
TAATLHALHYHQIDVQAVQQQLERTDYASVRDELLDGLLTIPVVETANWSADEIRAELDN
NAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTREQVEE
TFKRMAQVVDQQNAGDPNYRPMAPSFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLQV
KNG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacccgcgcggcggactgcaggtcgccgccaatctcgaccagttcgtc
gaaaccgaagccctgcccggcaccggaattgacagcgccgcattctggtcaggtttcgac
gcactcgtgcacgagttggcgcctaaaaaccatgcgctgctcgccgagcgcgaccgcctg
caaacggaactggacaactggcatcgcgccaatcccgggccggtgcgcgacttgcgagcc
tatcgtgcgtttctcggaggcatcggctatatcgtaccggcgcctgcgagcgtgaaagca
acgaccgaccaggtcgacaccgaaatcgccgaacaggcgggcccgcaactcgtggtgcct
ctgtcgaatcagcgctatgcgctgaacgcggcgaacgcgcgctggggcagcctgtacgac
gcactctacggcactgacgcgattcccgagaccaacggcgcggacagacagaagactttc
aacccggtgcgcggcgctgcggtgatcgcctatgcccgcaagtttctcgacgaagcggca
ccgctcgcgaacggctcgcatgccgatgcgactcgctatagcgtggaaggcggcaagctg
gccgtcgcgctgaagaacggaacgagcgaactcaaaacgcccgcgcaattcatcggctat
cagggcgacgcgagcgcgccgtcggcggtgctgctcaaacataacgggctgcacttcgag
attcagatcgacgcgaacgactcgatcggcaagaccgacgccgcgcatgtgaaggacgtg
gtggtcgaagcggcggtgagcacgatcatcgactgcgaagactccgttgcggccgtcgat
gcagatgacaaggttcagctctatcgaaactggctcggtctgatgaacggcgatctgacc
gaagaggtcacgaagaacggcaagaccttcacgcgccggctgaacgacgaccgcgtgtac
gtcgccgcgaacggcacggcgcccgtcgtactgcatggccgctcgctgctgttcatccgc
aacgtcggtcatttgatgaccaatccggccgttttgacgaaggacggcgccgagattccc
gagggcatcctcgacgccgtgatgacgacgctgtgcgcgttgcacgaccgcaaacacaag
ttgaattcgcgcaccggctcgatctatatcgtgaagccgaaaatgcacggtcccgccgaa
gtcgcgtttgcgagcgaactgttcgcgcgcgtcgaagatctgctgaagctgccgcgtaac
acgatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaatctgctcgcatgt
attgccgaggcgtcggaacgcgtggcgttcatcaacacgggctttctcgaccggaccggc
gacgaaatgcacagcgcgatggaagccggcccgatgatgcgcaagggcgacatgaagtcg
agcgcatggatcgccgcatacgaacgtagcaacgtgctcgtcggtttgcacgcgggcctg
cgcggccgctcgcagatcggcaagggcatgtgggccatgcccgatctgatgcacgccatg
ctcgaacagaagatcgcgcatccgaaggccggcgcgaacactgcatgggtgccctcgccg
accgcggcaacgctgcatgcgctgcactatcatcagatcgacgtgcaggcggttcagcag
caactggagcgcaccgactatgcgagcgtccgcgacgaactgctggacggcctgctgacg
attcccgtcgtcgaaacggccaactggagcgccgacgagatccgcgccgaactcgacaac
aacgcgcaaggcattctgggctacgtggtgcgctggatcgatcagggcgtgggctgctcg
aaggtgcccgatattcacgacgtcggcctgatggaagaccgcgcaacgttgcgtatctcg
agccagcacattgcgaactggctgtatcacggcgtggtgacgcgcgagcaggtcgaggag
acctttaaacgcatggcgcaagtggtcgatcagcagaacgccggcgatccgaattacagg
cccatggcgccctcgttcgacaccatcgcattcaaggccgcgcaagcactggtattcgaa
ggacgccagcagccgagcggctacaccgaaccgttgctgcacaagttccgtctgcaagtg
aagaacggctga

DBGET integrated database retrieval system