KEGG   Paraburkholderia caledonica: CUJ87_09575Help
Entry
CUJ87_09575       CDS       T05740                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00071  Fatty acid degradation
pcj00072  Synthesis and degradation of ketone bodies
pcj00280  Valine, leucine and isoleucine degradation
pcj00310  Lysine degradation
pcj00362  Benzoate degradation
pcj00380  Tryptophan metabolism
pcj00620  Pyruvate metabolism
pcj00630  Glyoxylate and dicarboxylate metabolism
pcj00640  Propanoate metabolism
pcj00650  Butanoate metabolism
pcj00900  Terpenoid backbone biosynthesis
pcj01100  Metabolic pathways
pcj01110  Biosynthesis of secondary metabolites
pcj01120  Microbial metabolism in diverse environments
pcj01200  Carbon metabolism
pcj01212  Fatty acid metabolism
pcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUJ87_09575
   00630 Glyoxylate and dicarboxylate metabolism
    CUJ87_09575
   00640 Propanoate metabolism
    CUJ87_09575
   00650 Butanoate metabolism
    CUJ87_09575
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CUJ87_09575
   00072 Synthesis and degradation of ketone bodies
    CUJ87_09575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CUJ87_09575
   00310 Lysine degradation
    CUJ87_09575
   00380 Tryptophan metabolism
    CUJ87_09575
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CUJ87_09575
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CUJ87_09575
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CUJ87_09575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcj04147]
    CUJ87_09575
Enzymes [BR:pcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CUJ87_09575
Exosome [BR:pcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CUJ87_09575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AXF14625
UniProt: A0A2Z5MB71
Position
PHRS4_A:2169959..2171260
Genome map
AA seq 433 aa AA seqDB search
MSHPLPPVRRVAIIGGNRIPFARSNTAYASASNQDMLTFTLQGLIDRFGLHGERLGEVAA
GAVIKHSRDFNLTRESVLSTTLARETPAYDVQQACGTGLEAAILVANKIALGQIEVGIAG
GVDTTSDAPIGVNEKMRKILLEANRGRSTGERVGALAKLRPAMFFKPLLPRNGEPRTGLS
MGEHCELMAKRWNISREAQDVLAYESHRKLAEAYARGFVNDLMTPYRGLARDNNLRSDLT
LDKLAALSPAFDRDAGTLTAGNSTPLTDGASAVLLASEEWAARHGLPVLAYLSWSETAAV
DFFDKKEGLLMAPAYAVPRMLTRAGLTLQDFDFYEIHEAFAAQVLCTLAAWQDDEYCRTQ
LGLDAPLGSIDSAKLNVNGGSLATGHPFAATGGRIVAGLAKMLAQLDKPAGTARGLISIC
AAGGQGVAAIIER
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacccgctgccacccgtgcgccgcgtcgcgataatcggcggtaaccggattccg
ttcgcacgctcgaacaccgcgtatgcgagcgcgtcgaatcaggacatgctgaccttcacg
ctgcaaggactgatcgaccgctttggcttgcacggcgaacgtctcggcgaagttgcggct
ggcgccgtcatcaagcattcgcgcgacttcaatctgacgcgcgaatccgtgctgtccacc
acactcgcgagggaaacgcccgcgtacgatgttcaacaggcctgcggtactgggctcgaa
gccgccatactcgtcgccaacaagatcgcgttgggacagatcgaagtgggtatcgcgggc
ggcgtcgatacgacatcggatgcgcccatcggcgtcaacgaaaagatgcgcaagattctg
ctcgaagcgaatcgcggcaggagtacgggcgagcgagtgggcgcgctcgcgaaactgcgg
ccagccatgtttttcaagccgctcctgccgcgcaacggcgagccgcgcaccggcctttcg
atgggcgagcactgcgaactgatggccaagcgctggaacatctcgcgcgaagcgcaggac
gtgctggcttacgagagtcaccgcaagctggccgaagcttacgcgcgcggtttcgtcaac
gatctgatgacgccgtatcgcggcctcgcgcgcgacaacaatctgcgctcggacctcacg
ctcgacaagctcgccgcgctttcgcccgccttcgatcgcgacgcgggcacgctgaccgcg
ggcaattcgacgccgctcaccgacggcgcctccgcggtactgcttgcaagcgaggaatgg
gccgcgcgccacgggttgccggtgctcgcctatctgagctggtcggaaaccgcggcagtc
gacttcttcgacaagaaagaaggccttttgatggcgcccgcctacgcggtgccgcgcatg
ctcacgcgagccggactgacgttgcaggacttcgatttctacgagatccacgaagcgttc
gcggcgcaggtgctgtgcacgctcgcggcgtggcaggatgacgaatactgccgcacgcag
ctcggcctcgacgcgccgctcggttcgatcgacagcgcgaagctcaacgtgaacggcggc
tcgctcgcaaccgggcatccgttcgcggcgacgggcgggcgcatcgttgcgggtctggcg
aaaatgctcgctcaactcgacaagccggcgggcacggcgcgtggactgatttcgatctgc
gcggcgggcggccagggcgtggcggcgataatcgagcgctga

DBGET integrated database retrieval system